The QVBoxLayout class lays out child widgets in a grid. ... QGridLayout  ( QWidget * parent, int nRows, int nCols, int border=0, int autoBorder = -1, const char * name=0 )  . ... void  addWidget  ( QWidget *, int row, int col, int align = 0 )  . ... void  setRowStretch  ( int row, int stretch )  . ... QGridLayout takes the space it gets (from its parent layout or from the mainWidget ()), divides it up into rows and columns, and puts each of the child widgets it manages into the correct cell(s). ...

Еще в разделе: (Показать все результаты (>667) - rtm-cs.sinp.msu.ru/ )

• Qt Tutorial - Chapter 10
• Apache module mod_auth_anon.c
• The MICO Binder (CORBA Extension)

Shows a complete history of a topic. ... When using PatternSkin enabling the HistoryPlugin changes the "History" link in the bottom action bar so it opens a page with a nice user interface where you can select the versions to compare. ... If RevCommentPlugin is installed and activated the "History" page will show the comments entered for each revision. ... Default layout: a simple list of topic revisions using the default format (see below) . ... Version: . ... Foswiki::Plugins::VERSION 1.024 . ...

Еще в разделе: (Показать все результаты (>2345) - wiki.cs.msu.ru/ )

• IncludeTopicsAndWebPages < System < Foswiki

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... как в матлабе записать квадратную матрицу в файл тхт? . ... Re: как в матлабе записать квадратную матрицу в файл тхт? [ re: Demandeur ] . ... attribute and its value. ...

Еще в разделе: (Показать все результаты (>2034) - www.snto-msu.net/ )

... Given package is a set of special commands and their handler - JOB program. The command aimed for description of often performed operations with files of PC-GAMESS program (dat, out, pun). ... Commands allow running calculation, performing other programs, data change between files and modification of files. ... Command inserts specified group in file.inp. ... del_g h2o.dat |Command deletes all repetition of| |$basis |specified group in file.inp. ... Command changes contents of group on specified | ...

Еще в разделе: (Показать все результаты (>98) - classic.chem.msu.su/ )

• Firefly DOCUMENTATION - command line arguments
• Lesson 3: two methods for preparing Firefly' input files with basis sets and

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6984) - mouse.belozersky.msu.ru/ )

• Example of alignment
• SVETKA, a program for multiple sequence alignments analysis
• Alignment example

О лаборатории . ... Лаборатория теоретической биофизики . ... Download script: memgen-0.0.1.tar.gz System requirements: python 2 (2.6 and higher), python openbabel library, python numpy library. ... continue reading..... ab initio basis sets cp2k education Firefly FRAP GAMESS gromacs MDAnalysis membrane mmb nano OPLS pymol python scipy sparse matrix toolset topology познавательно учебные материалы . OPLS-AA patch for different types of molecules . ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>45) - erg.biophys.msu.ru/ )

• python ERG Research Group: Лаборатория теоретической биофизики
• Peter Mamonov ERG Research Group: Лаборатория теоретической биофизики
• GAMESS ERG Research Group: Лаборатория теоретической биофизики

... The LanHEP input file is the sequence of statements, each starts with a special identifier (such as parameter, lterm etc) and ends with the full-stop ' . ... This section is aimed to clarify the syntax of LanHEP input files, i.e. the structure of the statements. ... Let us consider the LanHEP input files for the Standard Model with both the t'Hooft-Feynman and unitary gauges. ... LanHEP allows the user to define several keys , and use these keys to branch among several variants of the model. ...

Еще в разделе: (Показать все результаты (>1456) - theory.sinp.msu.ru/ )

• Mail::SpamAssassin::Conf - SpamAssassin configuration file
• The genEvents command
• Checking the correctness of the model

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>27) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search

fitshdr - FITS-file headers manipulation tool fitshdr [options] [FITSfile_name] . ... fitshdr [options] --edit FITSfile_name . ... If You want to modify headers of FITSFILE using new FITS-header lines from HEADER file (or from stdin), You have to use this option (You can skip this option, if -H or --header option is used). ... Empty header lines are not displayed (in 'dump' mode only). --line-offsets . ... In 'dump' mode: file offset will be displayed for each header line. --no-line-offsets . ...

Еще в разделе: (Показать все результаты (>341) - lnfm1.sai.msu.ru/ )

• Manpage of FITSHDR_EDIT

Russian depictives and attributives: the role of the verb Russian secondary predicates can use two different case patterns: the instrumental case or the agreeing case. In this paper we discuss the behavior of the adjective in the position of the secondary predicate and we refer to the patterns of agreement discussed above as depictive constructions (taking the instrumental) and attributive constructions (taking the agreeing case), see the examples (1-2). ... Predicate nouns in Russian. ...

Еще в разделе: (Показать все результаты (>282) - www.philol.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>169) - tukachev.flogiston.ru/ )

• Category: Новости
• Statistics One, Assignment One
• Statistics 1, Assignment 2

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>574) - monkey.belozersky.msu.ru/ )

• About this project
• ETS numeration assumed
• SDPpred

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>141) - bioinf.fbb.msu.ru/ )

• SDPpred
• Alignment example
• Input Formats

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

36. June 2010 Лаборатория лазерной интерферометрии

37. Instructions for Authors, contributing to “GEOGRAPHY, ENVIRONMENT,

38. Fortran DVM language description. Part 1 (1-4)

39. http://srd.sinp.msu.ru/nymmik/models/bazilevskaya_2.pdf

40. Uropatagium venation pattern in bats as diagnostic character (by the example of