... Prev . Next . ... Б•еп?я?я? я?п©я?я?пў я?п©я?я?п п• я?піп?п?, я€я?п?я€пўп©п?п©я?п?п?п· я?п?я?я?пЇп© #NUM!. Б•еп?я?я? @k <= 0 я?я?я? @k я?я?я?п?п?я? пЇя?я?я?п?я?п?п?я€п© п?я?я?я?я?я?п?я?я€ я?п©я?я?п п•, я€я?п?я€пўп©п?п©я?п?п?п· я?п?я?я?пЇп© #NUM!. п?п?п© п?пія?пЇпєя?п· п?я?я€я?я?п?п?я?я?п© п? Excel. ... A5 п?я?я?я?пўпІп©п? п?я?п?я?п© 11.4, 17.3, 21.3, 25.9 я? 40.1. п?я?я?я?п© . ...

Еще в разделе: (Показать все результаты (>311) - uneex.lorien.cs.msu.su/ )

• Chapter??13.?? Toolbox
• A Few Handy Queries

... Previous message: [RU-NGI] Fwd: Re: [www.dcache.org #7066] recomendations for large dCache installations . Next message: [RU-NGI] Monitoring of our CreamCe . Messages sorted by: [ date ] [ thread ] [ subject ] [ author ] . ... Так как мы у себя планируем новую установку для SE ATLAS, я спросил > рекомендации на dCache SE размером 1PB и дальше. ... RU-NGI mailing list > RU-NGI at theory.sinp.msu.ru > http://theory.sinp.msu.ru/mailman/listinfo/ru-ngi > -- Best regards, Valery Mitsyn . ...

Еще в разделе: (Показать все результаты (>1628) - theory.sinp.msu.ru/ )

• intas:cern-intas03:task1 [THEP]
• Mikhail N. Smolyakov
• Menu 6.

... Our Partners . ... URALCHEM Holding P.L.C., a company incorporated in Cyprus and the holding company for URALCHEM Group, one of the largest producers of nitrogen and phosphate fertilizers in Russia and the CIS. ... Thermodynamics center of precise calorymetry investigations.  ... Facility for the Analysis of Chemical Thermodynamics ( Decterov S.A.  ? ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>92) - td.chem.msu.ru/ )

• Carbamide Laboratory of Chemical Thermodynamics

PHP Manual . ... History of PHP . History of PHP related projects . Books about PHP . ... One of the biggest strengths of PHP 3.0 was its strong extensibility features. ... The whole new language was released under a new name, that removed the implication of limited personal use that the PHP/FI 2.0 name held. ... PHP 4.0, based on this engine, and coupled with a wide range of additional new features, was officially released in May 2000, almost two years after its predecessor, PHP 3.0. ...

Еще в разделе: (Показать все результаты (>254) - oit.cmc.msu.ru/ )

• PostgreSQL functions
• Common Pitfalls
• pg_locreate

. [ Войти ] . Главная -> Фильмы -> Wanda at Large . Пользователи . Демо . Деньги . Фильмы . Форум . Wanda at Large . США 2003 . отметить . Сериал . Комедия .

Еще в разделе: (Показать все результаты (>765) - kinfo.ru/ )

• At Large with Geraldo Rivera - Фильмы - Kinfo.ru
• Dave Allen at Large - Фильмы - Kinfo.ru
• Masterchef Goes Large - Фильмы - Kinfo.ru

... Submit your article . ... Public Administration publishes scholarly articles on theory, methodology and practice of management, results of applied research projects in administration, studies of Russian and foreign administration experience, bibliographical reviews and information on conferences, round tables and workshops. ... The journal accepts polemic articles. ... All articles submitted for publication are first reviewed for compliance with the guidelines for article formatting and content. ...

Еще в разделе: (Показать все результаты (>244) - ee-journal.spa.msu.ru/ )

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... P.M. , Adam?k P. , Artemyev A.V. , Belskii E. , Both C. , Bure? ... Lehtonen P.K. , Laaksonen T. , Artemyev A.V. , Belskii E. , Berg P.R. , Both C. , Buggiotti L. , Bure? ... Lehtonen P.K. , Laaksonen T. , Artemyev A.V. , Belskii E. , Both C. , Bure? ... Авторы: Adamik P. , Artemyev A.V. , Belskii E. , Both C. , Bure? ...

Еще в разделе: (Показать все результаты (>2388) - istina.msu.ru/ )

• IEEE Transactions on Very Large Scale Integration (VLSI) Systems - журнал |
• Sirki? P.M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Bure? S. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... Полная версия этой страницы: A large IT company is looking for J2EE Developer . Студенческий форум Физфака МГУ > Общий > Работа . ... Design, coding, testing, implementation and production support of enterprise-level J2EE applications; Business analysis, discovery, and technical specification development; J2EE cross-training activities; career- and goal-oriented; . ...

Еще в разделе: (Показать все результаты (>482) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > A large company is looking for Senior J2EE
• Студенческий форум Физфака МГУ > Ph.D. in Large Lakes Observatory (University
• A large IT company is looking for J2EE Developer - Студенческий форум Физфака

... Russian Pages . CDFE: Home Page . ... Numerical data, graphics, and bibliography . ... description] . Last updated: May 6th, 2014 . ... Last updated: June 15th, 2011 . ... Last updated: . ... Last updated: April 4th, 2015 . ... Last updated: February 25th, 2016 . ... Last updated: September 27th, 2011 . ... Photonuclear Data Index since 1955 . ... Last updated: September 15th, 2015 . ... Last updated: March 22th, 2010 . ... Last updated: March 19th, 2015 . ... Last updated: May 15th, 2002 . ...

Еще в разделе: (Показать все результаты (>43) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Calculator and Graph Engine for Atomic Nuclei

... Государственный Астрономический Институт имени П.К. Штернберга МГУ . ... Семинары ГАИШ . ... Государственный астрономический институт им. П.К.Штернберга (ГАИШ) научно-исследовательский институт, являющийся одним из подразделений МГУ им. М.В. Ломоносова . ... 11 декабря 2006 года исполнилось 175 лет со дня создания на Пресне Астрономической обсерватории Московского университета, ставшей впоследствии базой для формирования Государственного астрономического института им. П.К. Штернберга (ГАИШ МГУ). ...

Еще в разделе: (Показать все результаты (>159) - sai.msu.ru/ )

• Презентация PowerPoint
• Future Prospects of Variable-Star Catalogues
• Конференции сайта АстрО

. S.I. Kudryashov, N.B. Zorov, A.A. Karabutov, Yu.Ya. Kuzyakov . Mendeleev Commun., v.1, p.22-24 (1997 ) . ABSTRACT . Vaporisation from rough surface areas during the laser ablation of foam graphite under vacuum generates a shock wave of recoil pressure of the vaporised substance which destroys the layer heated by radiation by desorbing large fragments from the material surface. Laboratory of Laser Diagnostics

Еще в разделе: (Показать все результаты (>476) - chem.msu.ru/ )

• Electric probe detection of large cluster ions in spinodal decomposition of the
• Publications of the Laboratory of Laser Diagnostics
• Publications of the Laboratory of Physics and Chemistry of Semiconductors

... Publication data for the ACAT'2002 Proceedings are available (you may download also a Word file ). ... Information on publication of the ACAT'2002 Proceedings and instructions on submission of contributions are available on our Web site. ... Everybody is invited to send interesting pictures! ... Materials (slides etc) of poster presentations appear in our Web data base (check "Programme" page). ... SLIDES of tutorials are available (check "Tutorials" page, then go to particular tutorial page). ...

Еще в разделе: (Показать все результаты (>55) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/page0.html
• http://acat02.sinp.msu.ru/26june.html
• http://acat02.sinp.msu.ru/24june.html

. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . PDB . Classification . Domain instances . Bonded with NA . 1BMV . VIRUS/RNA . 1 . 0 . 1PGL . VIRUS/RNA . 1 . 1 . total (2 entries) . 2 . 1 . No comments on this family . Send your questions and comments to sas@belozersky.msu.ru .

Еще в разделе: (Показать все результаты (>166) - monkey.belozersky.msu.ru/ )

• S publications
• SCOP classification

... The role of wine tax-farming system in the forming of large capitals in Russia in the 19th century, . ... The article is devoted to one of the most profitable business activities in Russia at the end of the 18th century to the beginning of the 1860s. The author researches the social and national structure of wine tax-farmers, the level of their incomes as well as the ways and methods of accumulation of capital, in particular, their ties with the aristocracy and state officials of all levels. ...

Еще в разделе: (Показать все результаты (>6402) - hist.msu.ru/ )

• Visual Images of Patriarch Nikon

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>1484) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~alex2308/align/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta_aligned.fasta

... Thursday, August 22, 2002 аа ORAL SESSION . ... Hamilton M. Acoustic Streaming in a Cylindrical Tube . ... Boudlal A. Nonlinear Stability of Roll Waves . ... Interaction of Acoustic and Temperature Fields in Thermoacoustics . ... Sugimoto N. Effects of Spatially Periodic Temperature Distribution on Amplification of Energy Flux of a Nonlinear Acoustic Pulse Propagating in a Gas-Filled Tube . ... Shugaev F. The Role of Acoustic Radiation During the Interaction of a Shock Wave with a Turbulent Flow . ...

Еще в разделе: (Показать все результаты (>127) - acs366.phys.msu.su/ )

• ISNA-16
• Abstract

... Publications . ... Laboratory of Mathematical Methods of Image Processing . ... Ridge and tree feature detection on images . Publication type . Conference paper . ... 11-th International Conference "Pattern Recognition and Image Analysis: New Information Technologies" . ... Using the results of scale space ridge detection as primary markup the lines are prolonged up to branch points and restored in places where they are not detected. ... Title = {Ridge and tree feature detection on images}, . ...

Еще в разделе: (Показать все результаты (>824) - imaging.cmc.msu.ru/ )

Laboratory of Informatics . Head of Laboratory E.S.Polischuk, senior researcher, DSc . ... research guidance of a four year student's project in the Faculty of Geography (N.M. Chernavskaya, DSc) . ... Grant of RFBF (Russian Foundation for Basic Research) 01-03-00332, the head of the project prof. R.B.Rybakov, Institute of Orientalistic (Russian Academy of Science), N. M. Chernavskaya - performer . ... N.M.Chernavskaya, DSc, senior researcher, T.B.Pleskacheva., DSc, senior researcher. ...

Еще в разделе: (Показать все результаты (>92) - srcc.msu.ru/ )

• D.Moss, D.Sokoloff, R.Beck, Ram pressure effects in the galactic plane and
• Moss D., Sokoloff D., Beck R., Ram pressure effects in the galactic plane and
• Brandenburg A., Sokoloff D., Subramanian K., Current status of turbulent dynamo

. A file system is a logical method for organising and storing large amounts of information in a way which makes it easy manage. The file is the smallest unit in which information is stored. The UNIX file system has several important features. Different types of file . Structure of the file system . Your home directory . Your current directory . Pathnames . Access permissions .

Еще в разделе: (Показать все результаты (>117) - comet.sai.msu.ru/ )

• Physics of the Solar Corona. Seminar 2012 December 20-21
• Previous and Proposed
• The IMG (Image) Element

XAFS spectroscopy is widely used in physics, materials science, chemistry (especially in catalysis and coordination chemistry), biology, geochemistry and environmental science. ... This is an interface to the Glimpse -based search engine which enables you to find published papers in different fields of x-ray absorption spectroscopy -- XAFS, EXAFS, XANES, NEXAFS, SEXAFS, XEOL, and EXAFS-like phenomena in photoemission, electron-energy-loss spectra and so on. ... Database Search Form . ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )