... Our Partners . ... URALCHEM Holding P.L.C., a company incorporated in Cyprus and the holding company for URALCHEM Group, one of the largest producers of nitrogen and phosphate fertilizers in Russia and the CIS. ... Thermodynamics center of precise calorymetry investigations.љ ... Facility for the Analysis of Chemical Thermodynamics ( Decterov S.A. љ? ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>92) - td.chem.msu.ru/ )

• Carbamide Laboratory of Chemical Thermodynamics

. [ Войти ] . Главная -> Фильмы -> Wanda at Large . Пользователи . Демо . Деньги . Фильмы . Форум . Wanda at Large . США 2003 . отметить . Сериал . Комедия .

Еще в разделе: (Показать все результаты (>498) - kinfo.ru/ )

• Masterchef Goes Large - Фильмы - Kinfo.ru
• At Large with Geraldo Rivera - Фильмы - Kinfo.ru
• Hero at Large - Фильмы - Kinfo.ru

... 21 Дек 2015 . кем editor | ... 16 Мар 2015 . ... Родилась 31.01 1932 г. 2 Мар 2015 . ... 5 Май 2015 . ... Декабрь 2015 . Ноябрь 2015 . ... 2016 С Днем Победы! ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate ...

Еще в разделе: (Показать все результаты (>96) - elana.sinp.msu.ru/ )

• Your car really need to be free of rust spots over the long-term to prevent

Automation tools for the documentation of large software packages" . Arushanyan O.B., Bogomolov N.A., Volchenskova N.I., Kovalev A.D. Some problems of documenting large software packages and a number of approaches to the automation of maintenance procedures for software documentation are considered. ... Arushanyan O.B. e-mail: arush@srcc.msu.ru ; Bogomolov N.A. e-mail: nbogom@srcc.msu.ru ; Volchenskova N.I. e-mail: nad1946@mail.ru ; Kovalev A.D. e-mail: kovalev@srcc.msu.ru ...

Еще в разделе: (Показать все результаты (>290) - num-meth.srcc.msu.ru/ )

• "Stationary distribution for the Jacobi equation with a large random curvature
• Parallel partitioning tool GridSpiderPar for large mesh decomposition
• "On the peculiarities of solving large systems of linear algebraic equations on

... Полная версия этой страницы: A large IT company is looking for J2EE Developer . Студенческий форум Физфака МГУ > Общий > Работа . ... Design, coding, testing, implementation and production support of enterprise-level J2EE applications; Business analysis, discovery, and technical specification development; J2EE cross-training activities; career- and goal-oriented; . ...

Еще в разделе: (Показать все результаты (>461) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > A large company is looking for Senior J2EE
• Студенческий форум Физфака МГУ > Ph.D. in Large Lakes Observatory (University
• A large IT company is looking for J2EE Developer - Студенческий форум Физфака

Prague, August 16, 2006 . ... Continue the GCVS project for at least 3 -6 more years;  for this period, continue publication of Name-Lists for individual discoveries and for large-survey stars studied also elsewhere;  during this period, start a new GCVS version with improved data and with complete information for Name-List stars; . during this period, work on Steve Kawaler's suggestion;  pay maximum attention to improving software for period determination, automatic classification, etc . ...

Еще в разделе: (Показать все результаты (>162) - sai.msu.ru/ )

• Future Prospects of Variable-Star Catalogues
• Конференции сайта АстрО
• WORKSHOP "STELLAR ATMOSPHERES" "THE CHEMICAL AND DYNAMIC EVOLUTION OF STARS AND

. Kudryashov S.I. , Zorov N.B. Mendeleev Communications, p. 178 (1998). Abstract . The electric probe procedure developed here has made it possible to detect for the first time large cluster ions, the products of spinodal decomposition of the laser-induced labile state of the liquid phase of carbon, with a size up to a million atoms and relative content in the mass distribution of the order of ppm. Laboratory of Laser Diagnostics

Еще в разделе: (Показать все результаты (>741) - chem.msu.ru/ )

• Formation of large carbon clusters during laser ablation of foam graphite
• Kinetic and thermodynamic properties of exciplexes with partial charge...
• Entrance Examinations - Main Round

... Authors: D. R. Anderson et al. arxiv:1101.3781 Сверхмассивные черные дыры не коррелируют с галактическими дисками или псевдобалджами (Supermassive black holes do not correlate with galaxy disks or pseudobulges) . ... arxiv:1101.3586 Массивное протоскопление галактик на красном смещении 5.3 (A massive proto-cluster of galaxies at a redshift of z {\approx} 5.3) . Authors: Peter L. Capak et al. arxiv:1101.2022 Первые результаты Планка: проект Планк (Planck Early Results: The Planck mission) . ...

Еще в разделе: (Показать все результаты (>497) - astro.uni-altai.ru/ )

• http://xray.sai.msu.ru/~polar/sci_rev/0304.html
• http://xray.sai.msu.ru/~polar/sci_rev/0803.html
• http://xray.sai.msu.ru/~polar/sci_rev/1203.html

... Bohm limit DB=vrg/3: Emax Emax ush 0.3 Ze B Rsh c 1014(B/Bism) Z eV B Hillas criterion ! ... Voelk 2000; Kang Jones 2006) - Bohm diffusion in amplified magnetic field B2/8 = 0.035 u2/2 ( Voelk et al. 2005 empirical; Bell 2004 , Zirakashvili VP 2008 theoretical) - account for Alfvenic drift w = u + Va upstream and downstream - relative SNR rates: SN Ia : IIP : Ib/c : IIb = 0.32 : 0.44 : 0.22 : 0.02 Chevalier 2004 , Leaman 2008, Smart et al 2004, Berezinsky et al 2006 Das et al. ...

Еще в разделе: (Показать все результаты (>8) - tunka.sinp.msu.ru/ )

• Workshop тАЬCosmic Ray Physics Large Scale Experiments at the Second Decade of

. Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . Тема обращения: . Описание проблемы: . Введите почтовый адрес: . Войти в систему . Регистрация . Главная . Поиск . Статистика . О проекте . Помощь . Издательство: Institute of Electrical and Electronics Engineers . Местоположение издательства: United States . ї 2011-2015 НИИ механики МГУ . Лаборатория 404. Все права защищены.

Еще в разделе: (Показать все результаты (>2398) - istina.msu.ru/ )

• M?gi M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Kosugi T. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Forsman J. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... Air pollution induced changes in pine needle chemistry were observed at sample sites in the surroundings of the Pechenganikel smelter. ... Close to the pollution source needles were enriched in Ni and Cu by needle age. Correlation and principal component analyses show that changes in the element composition of pine needles depended on air pollution and on natural factors as well. The contribution from air pollution increased with needle age. ...

Еще в разделе: (Показать все результаты (>24) - eco.soil.msu.ru/ )

• THEORETICAL PRINCIPLES AND METHODS OF REMEDIATION OF SOILS POLLUTED WITH HEAVY

. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . PDB . Classification . Domain instances . Bonded with NA . 1BMV . VIRUS/RNA . 1 . 0 . 1PGL . VIRUS/RNA . 1 . 1 . total (2 entries) . 2 . 1 . No comments on this family . Send your questions and comments to sas@belozersky.msu.ru .

Еще в разделе: (Показать все результаты (>180) - monkey.belozersky.msu.ru/ )

• SCOP classification

Network Working Group R. Skelton Request for Comments: 1673 EPRI Category: Informational August 1994 Electric Power Research Institute Comments on IPng Status of this Memo This memo provides information for the Internet community. This memo does not specify an Internet standard of any kind. ... Skelton [Page 2] RFC 1673 EPRI Comments on IPng August 1994 - Routing table economy Network addressing must achieve significant economy in routing database size with very large networks. ...

Еще в разделе: (Показать все результаты (>18070) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc1673.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/internet-drafts/draft-levine-smtp-compress-00.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc7346.txt.pdf

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>32) - observ.pereplet.ru/ )

Identifiability analysis and predictive power of the gene circuit model Ekaterina Myasnikova St.Petersburg State Polytechnical University, 29 Politekhnicheskaya, 195251, St.Petersburg, Russia, e-mail: myasnikova@spbcas.ru The correct prediction of system behavior is a necessary property of a mathematical model that is largely determined by the identifiability of model parameters. The number of parameters that are estimated by fitting to experimental data is typically large. ...

Еще в разделе: (Показать все результаты (>256) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/106.pdf

Microsymposium 34, MS015, 2001 TO THE DISCOVERY OF THE "SOUTH POLE - AITKEN " BASIN. ... Head [2] and Spudis [1] suggested in their reviews that the existense of the structure identified later as the South Pole - Aitken baasin was first predicted on the basis of a relief analysis of the mountain ridges observed in the libration zone be Hartman and Kuiper [7], i.e. after the first images of the lunar far-side had been obtained. ... SOUTH POLE-AIKEN BASIN: V.I.Chikmachev et al. ...

Еще в разделе: (Показать все результаты (>115) - selena.sai.msu.ru/ )

• Vladimir V. Busarev

... The role of wine tax-farming system in the forming of large capitals in Russia in the 19th century, . ... The article is devoted to one of the most profitable business activities in Russia at the end of the 18th century to the beginning of the 1860s. The author researches the social and national structure of wine tax-farmers, the level of their incomes as well as the ways and methods of accumulation of capital, in particular, their ties with the aristocracy and state officials of all levels. ...

Еще в разделе: (Показать все результаты (>3283) - hist.msu.ru/ )

• Visual Images of Patriarch Nikon

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>800) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta_aligned.fasta

... Thursday, August 22, 2002 аа ORAL SESSION . ... Hamilton M. Acoustic Streaming in a Cylindrical Tube . ... Boudlal A. Nonlinear Stability of Roll Waves . ... Interaction of Acoustic and Temperature Fields in Thermoacoustics . ... Sugimoto N. Effects of Spatially Periodic Temperature Distribution on Amplification of Energy Flux of a Nonlinear Acoustic Pulse Propagating in a Gas-Filled Tube . ... Shugaev F. The Role of Acoustic Radiation During the Interaction of a Shock Wave with a Turbulent Flow . ...

Еще в разделе: (Показать все результаты (>183) - acs366.phys.msu.su/ )

• ISNA-16
• Abstract

trendence Graduate Barometer Europe 2011 About the survey ­ About trendence trendence Graduate Barometer Europe is an annual online student survey which allows students to express their opinion on topics re lated to career and education. ... Ulrike Heyne Project Manager trendence Graduate Barometer Europe 2011 About the survey Facts and benefits How does it work? ... If your students take part in the trendence Graduate Barometer, they will receive an exclusive Student Report. ...

Еще в разделе: (Показать все результаты (>3) - studsov.math.msu.su/ )