... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>169) - tukachev.flogiston.ru/ )

• Category: Новости
• Statistics One, Assignment One
• Tag: КФА

You are here: Foswiki > Sandbox Web > WebIndex (revision 1) E dit A ttach . ... Comments Example comment topic for CommentPluginExamples "return" Target comment output 1 Main.ProjectContributor 03 Dec 2006 Target comment output 2 Main .. NEW - 27 May 2010 - 20:28 by ProjectContributor . ... NEW - 08 Feb 2009 - 04:38 by ProjectContributor . ... GenPDFAddOn Child Topic Header Level 2 This is a First level child below the PDF Demo topic. ... NEW - 06 Jan 2010 - 21:11 by ProjectContributor . ...

Еще в разделе: (Показать все результаты (>2246) - wiki.cs.msu.ru/ )

• (backlinks in Sandbox Web) CommentPluginExamples < Sandbox < Foswiki
• WebChanges < Sandbox < Foswiki

... The LanHEP input file is the sequence of statements, each starts with a special identifier (such as parameter, lterm etc) and ends with the full-stop ' . ... This section is aimed to clarify the syntax of LanHEP input files, i.e. the structure of the statements. ... Let us consider the LanHEP input files for the Standard Model with both the t'Hooft-Feynman and unitary gauges. ... LanHEP allows the user to define several keys , and use these keys to branch among several variants of the model. ...

Еще в разделе: (Показать все результаты (>3053) - theory.sinp.msu.ru/ )

• Institutes
• intas:cern-intas03:main [THEP]
• intas:cern-intas03:teams [THEP]

... Новости . ... Музей . антропологии . ... Вестник МГУ Антропология . ... 26 ноября Музее антропологии открылась этнографическая выставка . ... Антропология" . ... Посмотреть фотографии . ... 2008-2010 Научно-исследовательский институт и Музей антропологии им.Д.Н.Анучина . Копирование материалов web-сайта только с разрешения администрации НИИ и Музея антропологии МГУ! ... При использовании материалов, размещенных на сайте НИИ и Музея антропологии МГУ, ссылка на источник обязательна! ...

Еще в разделе: (Показать все результаты (>29) - www.anthropos.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>14) - storage.bioinf.fbb.msu.ru/ )

... This file is part of an example program for Qt. This example ** program may be used, distributed and modified without limitation. ** *****************************************************************************/ #include tooltip .h #include qapplication.h #include qpainter.h #include stdlib.h DynamicTip::DynamicTip( QWidget ... explicit initialization needed } void DynamicTip::maybeTip( const QPoint pos ) { if ( !parentWidget()- inherits( TellMe ) ) return ; ...

Еще в разделе: (Показать все результаты (>597) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - connect/connect.cpp example file
• VMailMgr-HOWTO
• Programming Languages mini-HOWTO

... The package installer is a scripting framework for MoinMoin which simplifies installing and delivering extensions for MoinMoin very much. ... The script contains one command (sounds complicated but is not really, look at the examples below) per line and gets executed from top to bottom. ... AddRevision|filename|pagename|author|comment|trivial . ... ReplaceUnderlayAttachment|filename in zip file|filename|pagename|author|comment . ... AddAttachment|filename in zip file|filename|pagename|author|comment...

Еще в разделе: (Показать все результаты (>231) - uneex.mithril.cs.msu.su/ )

• HelpOnMoinWikiSyntax - UNИX
• HelpOnProcessingInstructions - UNИX
• HelpOnComments - UNИX

... The package installer is a scripting framework for MoinMoin which simplifies installing and delivering extensions for MoinMoin very much. ... The script contains one command (sounds complicated but is not really, look at the examples below) per line and gets executed from top to bottom. ... AddRevision|filename|pagename|author|comment|trivial . ... ReplaceUnderlayAttachment|filename in zip file|filename|pagename|author|comment . ... AddAttachment|filename in zip file|filename|pagename|author|comment...

Еще в разделе: (Показать все результаты (>867) - uneex.lorien.cs.msu.su/ )

• HelpOnMoinWikiSyntax - UNИX
• HelpOnProcessingInstructions - UNИX
• mod_imap - Apache HTTP Server

The Department of Talented Youth Affairs and Professional Orientation . ... Older posts . Posted on 09.11.2015 by admin . ... The team competitions Continue reading . Posted in News , Без рубрики | Leave a comment . ... In the 2015/16 Continue reading . ... The festival is organized by the Department of Continue reading . ... Posted on 17.11.2014 by admin . ... Federal Agency for Youth Affairs ?Rosmolodezh?, ... 2016 - The Department of Talented Youth Affairs and Professional Orientation ...

Еще в разделе: (Показать все результаты (>168) - talant.msu.ru/ )

• admin | The Department of Talented Youth Affairs and Professional Orientation |
• editor | The Department of Talented Youth Affairs and Professional Orientation

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>30) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

... Institute for Solid State Physics has a solid tradition of preparing students for advanced degrees and successful careers. The high quality of scientific researches performed in the ISSP is mostly due to thorough and industrious training of scientific personnel. The departments of the Moscow Institute for Physics and Technology , Faculty of Physics of M.V.Lomonosov Moscow State University and Moscow Institute of Steel and Alloys work closely with our Institute. ... e-mail: univer issp.ac.ru . ...

Еще в разделе: (Показать все результаты (>25) - www.issp.ac.ru/ )

• International Science Olympiads

... Monday, July 5th, 2010 . ... http://img-fotki NULL .yandex NULL .ru/get/5102/mironyc NULL .3f/0_2b1a9_24ed0749_XL NULL .jpg) . ... Posted in Uncategorized | ... На сайт добавлен пакет Lightbox 2.04 (http://www NULL .huddletogether NULL .com/projects/lightbox2/) (by Lokesh Dhakar) для отображения графики с дополнительными визуальными эффектами: . ... Наши публикации . ... Публикации за 2011 . Публикации за 2012 . ... Лаборатория лазерной интерферометрии is proudly powered by WordPress . ...

Еще в разделе: (Показать все результаты (>46) - geo.sai.msu.ru/ )

• June 2010 Лаборатория лазерной интерферометрии
• Lightbox 2 Лаборатория лазерной интерферометрии
• site lightbox Лаборатория лазерной интерферометрии

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Online . ... More than 40 000 students (graduate and postgraduate) and about 7 000 undergraduates study at the university, and over 5 000 specialists do the refresher course here. ... Moscow University campus is an extremely complex system, with its 1 000 000 m2 floor area in 1 000 buildings and structures, with its 8 dormitories housing over 12 000 students and 300 km of utility lines. ...

Еще в разделе: (Показать все результаты (>197) - www.msu.ru/ )

• MSU institutes
• The scheme of an arrangement of MSU buildings on Leninskiye Gory
• MSU Institutes

... About Trac . ... Browse Source . ... The page is written like: {{{ #!rst Examples: * Tickets: : trac :`#1` or : trac :` ticket :1` * Ticket comments: : trac :`comment: ticket :1:2` * Reports: : trac :`{1}` or : trac :`report:1` * Changesets: : trac :`r1`, : trac :`[1]` or : trac :`changeset:1` * Revision log : : trac :`r1:3`, : trac :`[1:3]` or : trac :` log :@1:3`, : trac :` log : trunk @1:3` * Diffs (since version 0.10): : trac :` ... Revision log: r1:3 , [1:3] or log:@1:3 , log:trunk@1:3 . ...

Еще в разделе: (Показать все результаты (>4154) - kodomo.cmm.msu.ru/ )

• WikiFormatting ? Tanchiki
• TracNavigation (diff) тАУ Tanchiki
• WikiProcessors тАУ Tanchiki

... 119991, Moscow, GSP-1, Leninskiye Gory, MSU, 2nd Educational Building, CMC Faculty, room 581 (Head of the laboratory) . ... The Laboratory of Industrial Mathematics (LIM) headed by Professor V.M. Goloviznin was established in the Faculty of Computational Mathematics and Cybernetics (CMC) of Lomonosov Moscow State University in 2011. ... Running specialised computer modelling and simulation, high-qualification and certification courses targeted at the engineers of the leading Russian industry. ...

Еще в разделе: (Показать все результаты (>234) - en.cs.msu.ru/ )

• Laboratory of Industrial Mathematics
• International Scientific Conference "Probability Theory and its Applications"

... Physics Department . ... Topics of term papers for the 2nd year students ( in Russian ) . Information about the chair for students (pdf 14 Mb, in Russian ) . ... Laboratory Courses . ... History of Research in Polymer and Crystal Physics at the Physics Dept., ... Laboratory of Amphiphilic Polymer Systems Theory (in Russian) . Laboratory of Associating Polymers and Colloidal Systems . ... Laboratory of Computer-Based Methods in Research on Complex Polymer and Biopolymer Systems (in Russian) . ...

Еще в разделе: (Показать все результаты (>391) - polly.phys.msu.ru/ )

• Useful links - Chair of Polymer and Crystal Physics
• Kozhunova Elena

... ACAT'2003 : IX INTERNATIONAL WORKSHOP ON ADVANCED COMPUTING AND ANALYSIS TECHNIQUES IN PHYSICS RESEARCH (ACAT03), 1-5 December, 2003, Tsukuba, Japan. ... Advanced Statistical Methods for Data Analysis Traditionally, researchers from high energy and nuclear physics together with experts in computer science take part in the ACAT series of workshops. ... Thus, researchers from these and other fields are welcome to join us in discussions on modern computing techniques and ways for new developments. ...

Еще в разделе: (Показать все результаты (>66) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/huhlaev/Metamake.doc

... Adams J.F. - Infinite Loop Spaces - Hermann Weyl Lectures the Institute for Advanced Study, Vol. ... Название: Infinite Loop Spaces - Hermann Weyl Lectures the Institute for Advanced Study, Vol. ... Автор: Adams J.F. Язык: . ... spaces 33-36 . ... space 44 48 . ring space 72 . ... Adams conjecture 132-141 . Adams conjecture, infinite-loop versions of 195-196 . Adams, J.F. and Priddy, S.B. (their theorem) 145-148 . ... Double loop-space 13 36 . ... Loop-spaces 3 12 . ...

Еще в разделе: (Показать все результаты (>13731) - lib.mexmat.ru/ )

• Marshal B. - XML by example :: Электронная библиотека попечительского совета
• Поиск книг, содержащих Comments :: Электронная библиотека попечительского
• Stevens R., Rago S.A. - Advanced Programming in the UNIX Environment ::