This module is contained in the modules/mod_example.c file, and is not compiled in by default. It illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... cp src/modules/example/* src/modules/ mymodule . ... Example . ...

Еще в разделе: (Показать все результаты (>582) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - trivial/trivial.cpp example file
• Qt Toolkit - progress/progress.cpp example file
• Example

... Credit Copyright: John Chumack Explanation: Is this coat hanger a star cluster or an asterism? This cosmic hang-up has been debated over much of last century, as astronomers wondered whether this binocular-visible object is really a physically associated open cluster or a chance projection . ... NASA Web Site Statements, Warnings, and Disclaimers . NASA Official: Jay Norris. ... Publications with keywords: asterism - open cluster . Publications with words: asterism - open cluster . ...

Еще в разделе: (Показать все результаты (>5133) - www.astronet.ru/ )

• Aurora Over New Zealand
• Journal "Peremennye Zvezdy"
• Астронет > Aurora Over New Zealand

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... TWikiSite 23 - 2003-12-16 - PeterThoeny . Line: 1 to 1 . A TWiki site is an easy-to-use, full-featured open communications environment: . people anywhere on the Web or on an intranet can meet . ... Changed: . ... MikeMannix - 12 May 2002 . ... TWiki operates like a whiteboard for the Web - it lets you and all other users write, place pictures and post links, anywhere on any page. ...

Еще в разделе: (Показать все результаты (>39882) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (7 vs. 8) - TWiki
• IncludeTopicsAndWebPages - TWiki - TWiki
• IncludeTopicsAndWebPages - TWiki - TWiki - (printable)

Next] [Previous] [Top] [Contents] [Index] [netCDF Home Page] [Unidata Home Page] . ... The Unidata Program Center has developed a units library to convert between formatted and binary forms of units specifications and perform unit algebra on the binary form. Though the units library is self-contained and there is no dependency between it and the netCDF library, it is nevertheless useful in writing generic netCDF programs and we suggest you obtain it. ... Celsius . ... nit (unit of photometry) . ...

Еще в разделе: (Показать все результаты (>26) - angel.cs.msu.su/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

The Trac Repository Browser = [[TracGuideToc]] The Trac repository browser can be used to browse specific revisions of directories and files stored in the repositories associated with the Trac environment. ''(since 0.12)'': At the top-level of the repository browser is the '''Repository Index''', listing all the configured repositories. ... It's also possible to browse directories or files as they were in history, at any given repository revision. ...

Еще в разделе: (Показать все результаты (>1862) - kodomo.cmm.msu.ru/ )

• example.snake in snakes тАУ Python Battle
• examples.zip тАУ Cyclyc Cell Automata
• WikiRestructuredText тАУ Tanchiki

... Key carbonatite localities that have been investigated as part of INTAS project 05-1000008-7938 ‘ Diamond and Graphite in Carbonate Magmas ’ are: (1) Western Greenland, where the distribution of kimberlites , lamproites and carbonatites is correlated with depth to a fossil subducted slab (personal communication, Nielsen 2008); (2) the Chagatai Complex of ... Generation of carbonatitic melt through partial melting of carbonated eclogite under mantle conditions. ...

Еще в разделе: (Показать все результаты (>449) - geo.web.ru/ )

• Pavel Yu. Pletchov
• Эксплозивные извержения вулканов Курило-Камчатского региона: механизм,

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>52) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>15) - tukachev.flogiston.ru/ )

• Category: Новости

... References . ... References to books should include the author's name; year of publication; title; page numbers where appropriate; publisher; place of publication, in the order given in the example below. ... Ramirez, F. J., Marquez, R. A. C., and Mondaca, G.: 1991, The 1877 great tsunami and the rapid local warning network in the coast of Northern Chile - South America, In: Proc. International Conference of Australian Earthquake Engineering Society , Brisbane, Australia, 25-1. ... Information . ...

Еще в разделе: (Показать все результаты (>17) - seac47-2.phys.msu.ru/ )

... West European and American literature and culture of XIX-XX centuries, literature as discourse, reception studies, history of the book . ... Moscow University Press, 1994. ... W. Stevens. тАУ History of American Literature. ... Board Member, Administrative Board of Moscow University . Board Member, Administrative Board of the School of Philology, Moscow University . Board Member, Specialized Dissertation Board for West-European and Slavic Literatures, School of Philology, Moscow University . ...

Еще в разделе: (Показать все результаты (>10) - discours.philol.msu.ru/ )

• About

... This family contains a protein with resolved 3D structure: Q8UK99_AGRT5/3-102 , pdb ID: 1vqy . SDPsite predicts following important positions (numbering corresponds to 1vqy ): . ... 90S, 55W . ... 76W, 8Y, 46G, 55W, 39G, 63R . ... 8Y, 39G, 55W, 63R, 76W, 90S . ... Mapping predictions onto structure of 1vqy : . Associated grouping: . Group 1 . Q7ZWJ6_BRARE/154-253 . Q6DJ76_XENTR/154-253 . ... NPS3B_HUMAN/146-245 . ...

Еще в разделе: (Показать все результаты (>135) - bioinf.fbb.msu.ru/ )

• SDPsite - PF01850
• SDPsite - PF01399
• SDPsite - PF01798

Психология имеет долгое прошлое, но довольно короткую историю" (Г. Эббингауз, 1908) . Статьи и ссылки по истории психологии. Конференции 2000 года. ... Millennium World Conference in Critical Psychology, Sidney, Australia . XXVII Congress of Psychology 2000, Stockholm, Sweden . ... CSS 2000, the annual online conference for the Association for Computers and the Social Sciences . ... CiP2000, Computers in Psychology Conference , 29th March - 31st March 2000, University of York, UK. ...

Еще в разделе: (Показать все результаты (>15) - psyberlink.flogiston.ru/ )

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>16) - mouse.belozersky.msu.ru/ )

• Geometrical core
• Example of alignment
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... Physics Department . ... Home :: Directions of Research :: Polymers with Associating Groups (experiment + theory + computer experiment) Structure and properties of aggregates, multiplets and clusters. ... Polymers with Strongly Interacting Groups: Theory for Non-Spherical Multiplets. ... Computer Simulation of Solutions of Telechelic Polymers with Associating End-Groups. ... Home :: Directions of Research :: Polymers with Associating Groups (experiment + theory + computer experiment) . ...

Еще в разделе: (Показать все результаты (>286) - polly.phys.msu.ru/ )

• Полимеры с сильно ассоциирующими группами (теория + компьютерный эксперимент) -
• Center for Thermochemistry of Macromolecules - Chair of Polymer and Crystal
• LEONID NIKOLAEVICH RASHKOVICH

... О UNИX . ... Examples . ... 1 s = raw_input () 2 repeat = 0 3 for i in xrange ( 1 , len ( s )+ 1 ): 4 found = 1 5 for k in xrange ( 1 , len ( s )/ i ): 6 equal = 0 7 for j in xrange ( i ): 8 if s [ j ]== s [ j + i * k ]: 9 equal += 1 10 if equal == i : 11 found += 1 12 if found * i == len ( s ): 13 if repeat < found : 14 repeat = found 15 print repeat . ... LecturesCMC/PythonIntro2014/06_FilesModulesSystem/Examples (последним исправлял пользователь PavelSutyrin 2014-11-05 12:16:59) . ...

Еще в разделе: (Показать все результаты (>174) - uneex.mithril.cs.msu.su/ )

• Index of /static/GimpDoc_EnRu/images/dialogs/examples
• HelpOnInstalling/FastCgi - UNИX
• HelpOnMoinCommand/ExportDump - UNИX

Summary of results and experience in Data Science Alexander P. Ryjov Associated Professor, Chair of Mathematical Foundations of Intelligent Systems, Department of Mechanics and Mathematics, Lomonosov Moscow State University, Professor and Head, Chair of Business Processes Management Systems, IT Business School, Russian Presidential Academy of National Economy and Public Administration. ... Systems for evaluation and monitoring of complex processes. ... Banks: credit scoring system. ...

Еще в разделе: (Показать все результаты (>68) - www.intsys.msu.ru/ )

• Intelligent Systems :: Staff :: Zolotykh Andrej Alexeevich
• Intelligent Systems :: Staff :: Strogalov Alexander Sergeevich :: Modeling
• Интеллектуальные системы :: Сотрудники :: Золотых Андрей Алексеевич

... Выпускники . ... Программа международных грантов American Association of University Woman предназначена для женщин с университетским образованием (студенток, аспиранток, специалистов со степенью). ... Выделяется также несколько грантов (размером от $5,000 до $7,000 каждая) для реализации проектов тех участников Программы международных грантов American Association of University Woman, которые были стипендиатами программы в 2001-2005 гг. ... Master's/First Professional Fellowship $18,000 . ...

Еще в разделе: (Показать все результаты (>560) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Обсуждение материала "American Association of University
• Клуб выпускников МГУ: Американские ученые придумали тест, оценивающий шансы
• Клуб выпускников МГУ: 52% североамериканцев считают, что иммигранты

. Name . Last modified . Size . Description . Parent Directory . - . alpha/ . 2007-02-10 22:19 . - . alpha_and_beta/ . 2007-02-10 22:19 . - . beta/ . 2007-02-10 22:19 . - . Apache/2.4.12 (Debian) Server at kodomo.fbb.msu.ru Port 80

Еще в разделе: (Показать все результаты (>7227) - kodomo.fbb.msu.ru/ )

• Help: templating
• snake: 954cc2774637 snakes/example.snake
• cca: a308291203ea Help/Help.html

... MBA . EXECUTIVE MBA . ... Программы . ВШБ МГУ - школе . ... 1 октября на программе "Магистр" состоялся семинар на тему "How to improve your intercultural skills". Семинар провел директор компании York Associates Боб Дигнен (Bob Dignen), который является одним из организаторов международной образовательной программы "Developing people internationally". ... Executive MBA . ... Семинары . ... Аккредитация программы Бакалавр . Аккредитация финансовых курсов программ Бакалавр и Магистр . ...

Еще в разделе: (Показать все результаты (>103) - www.mgubs.ru/ )

• Уважаемые студенты МА008 и МА009! 9 сентября в 17:30 в ВШБ состоится лекция
• Уважаемые студенты МВА016 и МВА017! 9 сентября в 17:30 в ВШБ состоится лекция