... ABSTRACT S. The rate constants for luminescence quenching of tris(2,2'- bipyridyl)ruthenium(II) complexes by sulphite ions and the ionic form of 1-bromo-2-naphthol and yields of free radical ions from radical-ion pairs are measured as functions of the salt concentration in an aqueous solution. ... The commonly accepted model allowing for variation in the diffusion rate of the reagents and formation of ion pairs upon addition of salts fails to account for the results obtained. ...

Еще в разделе: (Показать все результаты (>268) - chem.msu.ru/ )

• Determination of Reaction Rate Constants in Micelles. A Comparison of the
• Moscow University Chemistry Bulletin Vol. 42, No. 2, P. 95 (2001)
• Kinetic and Thermodynamic Properties of Aromatic Compounds Exciplexes in

... Главная -> Фильмы -> The Constant Gardener . ... Фильмы . ... The Constant Gardener . ... John Sibi-Okumu . ... John Moller . ... Ben Parker . ... Джастин и Тесс Куэйл ? участвуют в британской дипломатической миссии в Кении. ... Рядом с телом девушки обнаруживают труп туземца, что бросает серьезную тень на ее репутацию и дает пищу для разного рода обидных толков.В надежде найти убийцу и восстановить доброе имя любимой жены, Джастин покидает пределы экзотической Кении и отправляется в Лондон. ...

Еще в разделе: (Показать все результаты (>60) - kinfo.ru/ )

• The Constant Nymph - Фильмы - Kinfo.ru
• A Constant Forge - Фильмы - Kinfo.ru
• The Constant Husband - Фильмы - Kinfo.ru

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ...

Еще в разделе: (Показать все результаты (>952) - istina.msu.ru/ )

• Implementation science : IS - журнал | ИСТИНА - Интеллектуальная Система
• Griboval-Constant Anne - сотрудник | ИСТИНА - Интеллектуальная Система
• Mechanics of Time-Dependent Materials - журнал | ИСТИНА - Интеллектуальная

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... Line: 1 to 1 . This class is PACKAGE PRIVATE to Store, and should never be . Changed: . ... Added: . Break circular references. $version if 0 or undef, or out of range (version number > number of revs) will return info about the latest revision. ... Get a meta-data block for this web . ... Search for a meta-data expression in the content of a web. $query must be a TWiki::Query object. ...

Еще в разделе: (Показать все результаты (>28171) - dualopt1.cmm.msu.ru/ )

• TWikiSystemRequirements - TWiki - TWiki
• %TOPICTITLE% (9 vs. 10) - TWiki
• %TOPICTITLE% (4 vs. 5) - TWiki

... Python . ... О UNИX . ... An implied loop in map() is faster than an explicit for loop; a while loop with an explicit loop counter is even slower. ... Try to use map() , filter() or reduce() to replace an explicit for loop, but only if you can use a built-in function: map with a built-in function beats for loop, but a for loop with in-line code beats map with a lambda function! ... LecturesCMC/PythonIntro2014/11_FurtherEducation (последним исправлял пользователь FrBrGeorge 2015-07-02 15:24:30) . ...

Еще в разделе: (Показать все результаты (>150) - uneex.lorien.cs.msu.su/ )

• Platform-Dependent Conditionals
• Platform-Dependent Tags
• Dynamic Shared Object (DSO) Support - Apache HTTP Server

New Developments in VertexReco Rudi FrЭhwir th, Kirill Prokofiev, Thomas Speer, Pascal Vanlaer, Wolfgang Waltenberger . ... NoPU 1 4 - NoPU 24 New Developments in Vertex Reconstruction ґ p.16/24 PCLMSFit - resolution in x Entries pclmse 485 0.0004564 0.01911 39.44 / 49 Mean RMS 2 / ndf - pulls in x 400 350 300 250 200 150 Entries Mean RMS pclmse 499 -0.03713 0.63 60 50 40 30 20 Constant_BG 47.83 ? 3.958 Mean _BG -0.0001747 ? 0.0004007 Sigma_BG Constant ...

Еще в разделе: (Показать все результаты (>47) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/tut3.html
• http://acat02.sinp.msu.ru/presentations/huhlaev/Metamake.doc

You are here: Foswiki > System Web > ReferenceManual > DeveloperDocumentationCategory > PerlDoc (19 Apr 2011, ProjectContributor ) E dit A ttach . ... internal package Foswiki::Query::Node is a Foswiki::Infix::Node . ... See Foswiki::Store::QueryAlgorithms for a full spec of the interface to query algorithms. A hash mapping short aliases for META: entry names. ... Note that no reference to the tom or data web or topic will be made, so you can simply pass an arbitrary Foswiki::Meta . ... System . ...

Еще в разделе: (Показать все результаты (>2819) - wiki.cmc.msu.ru/ )

• JQueryTextboxList < System < Foswiki
• AppendixEncodeURLsWithUTF8 < System < Foswiki

... Param?tres . ... Centre de Donn es sur les Satellites Naturels. Param tres et constantes . ... Satellites de Mars . Satellites de Jupiter . Satellites de Saturne . Satellites de Uranus . Satellites de Neptune . Satellite de Pluton . Masses de satellites . Dimensions de satellites . Param tres photom triques de satellites . Param tres de rotation et p les . El ments orbitaux moyens des satellites lointains de Jupiter, Saturne, Uranus et Neptune . ...

Еще в разделе: (Показать все результаты (>126) - lnfm1.sai.msu.ru/ )

• IMCCE-SAI: Natural Satellites Service. Ephemerides.
• IMCCE-SAI: Natural Satellites Service. Ephemerides. Satellites de Mars
• IMCCE-SAI: Natural Satellites Service. Ephemerides. Satellites lointains de

... PDB . ... Domain instances . ... POLYMERASE/COMPLEX . ... POLYMERASE . ... TRANSFERASE/RNA . ... TRANSFERASE . ... total (16 entries) . ... No comments on this family . Send your questions and comments to sas@belozersky.msu.ru . ...

Еще в разделе: (Показать все результаты (>2) - mouse.belozersky.msu.ru/ )

... PDB . ... Domain instances . ... POLYMERASE/COMPLEX . ... POLYMERASE . ... TRANSFERASE/RNA . ... TRANSFERASE . ... total (16 entries) . ... No comments on this family . ...

Еще в разделе: (Показать все результаты (>203) - monkey.belozersky.msu.ru/ )

• PDB entries containing domains of the family "Viral RNA dependent RNA
• PDB entries containing domains of the family "ATP dependent DNA ligase domain"
• PDB entries containing domains of the family "Iron dependent repressor,

... On Double Waves of Homogeneous Systems of 4 Quasilinear Equations . ... The study of autonomous homogeneous overdetermined system with two dependent variables and three independent variables is considered in the presentation. The research is separated in two parts. In the first part we classify all systems, which have solutions with functional arbitrariness. ... Full analysis of double waves for two dimensional equations of rigid plastic body is given. ...

Еще в разделе: (Показать все результаты (>69) - acs366.phys.msu.su/ )

... Python . ... О UNИX . ... An implied loop in map() is faster than an explicit for loop; a while loop with an explicit loop counter is even slower. ... Try to use map() , filter() or reduce() to replace an explicit for loop, but only if you can use a built-in function: map with a built-in function beats for loop, but a for loop with in-line code beats map with a lambda function! ... LecturesCMC/PythonIntro2014/11_FurtherEducation (последним исправлял пользователь FrBrGeorge 2015-07-02 15:24:30) . ...

Еще в разделе: (Показать все результаты (>29) - uneex.mithril.cs.msu.su/ )

... AlgoWiki: an Open Encyclopedia of Parallel Algorithmic Features . ... SIGMA: Collective Bank of Tests on Parallel Computing . ... AlgoWiki is an open encyclopedia of algorithmsтАЩ properties and features of their implementations on different hardware and software platforms, from mobile to extreme scale, which allows for collaboration with the worldwide computing community on algorithm descriptions. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ... Joint MSU-Intel Center ...

Еще в разделе: (Показать все результаты (>22) - hpc.msu.ru/ )

... About lab . ... Selected publications . Publications . ... Conference "GraphiCon" . Online Journal "Computer graphics and multimedia" (in russian) . ... View-Dependent Octree Image Rendering . Publication Type . Conference Paper . Year of Publication . ... Conference Name . ... Publication Language . ... http://graphics.cs.msu.ru/en/publications/text/gc2003z.pdf . ...

Еще в разделе: (Показать все результаты (>94) - graphics.cs.msu.ru/ )

• View-Dependent Octree Image Rendering | Лаборатория компьютерной графики и
• GML LidarK Library | Graphics and Media Lab
• Avoiding Boosting Overfitting by Removing "Confusing Samples" | Лаборатория

Универсальные постоянные . ... Avogadro constant . ... атомная единица массы (а.е.м.) . ... atomic mass unit . ... molar gas constant . ... электрон - заряд . ... Electron charge . ... электрон - масса . ... Electron mass . ... электрон - молярная масса . ... Electron molar mass . ... Electron magnetic moment . ... Proton molar mass . ... При необходимости использовать константы с максимальной точностью, можно воспользоваться данными CODATA Task Group on Fundamental Physical Constants см. здесь . ...

Еще в разделе: (Показать все результаты (>43) - www.kosmofizika.ru/ )

... Phosphorylation by cyclic AMP-dependent protein kinase inhibits chaperone-like activity of human HSP22 in vitro. ... Human small heat shock protein with molecular mass 22 kD (HSP22, HspB8) contains two Ser residues (Ser24 and Ser57) in consensus sequence RXS and is effectively phosphorylated by cAMP-dependent protein kinase in vitro. ... Thus, phosphorylation by cAMP-dependent protein kinase affects the structure and decreases chaperone-like activity of HSP22 in vitro. ...

Еще в разделе: (Показать все результаты (>62) - biochem.bio.msu.ru/ )

• Redox-dependent change of nucleotide affinity to the active site of the
• Ammonium-dependent hydrogen peroxide production by mitochondria.
• Requirement of medium ADP for the steady-state hydrolysis of ATP by the

... 6, 1997 PROPER-TIME CLASSICAL ELECTRODYNAMICS Tepper L. Gill 1 Institute for Advanced Study Princeton, New Jersey 08540 gill@ias. edu W. W. Zachary and James Lindesay Howard University Washington District of Columbia 20059 Received 28 March 1997; revised 15 October 1997 We construct a generalization of Maxwell's equations associated with the proper-time of the source which accounts for radiation reaction without any assumptions concerning the nature of the source. ...

Еще в разделе: (Показать все результаты (>300) - chronos.msu.ru/ )

• P.V.Poluyan. Numbers in Space
• Laboratory-Division Quantum Electrodynamics of Self-Organizing Systems and
• Dynamic Equilibrium of The Atemporal Universe

sw|Q6FCI2|CLPS_ACIAD ATP-dependent Clp protease adapter protein clpS. ... MGKTNDWLDFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQ LMLAVHYQGKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEKA >sw|P0A8Q8|CLPS_ECO57 ATP-dependent Clp protease adapter protein clpS. ... MGKNNDWLNFEHLVKDKQIEALQPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQ LMLNVHYQGKAICGVFTAEVAETKVAHVNQYARENEHPLLCTLEKA >sw|Q1CA97|CLPS_YERPA ATP-dependent Clp protease adapter protein clpS. ...

Еще в разделе: (Показать все результаты (>793) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~aelita/Term2/fasta94_gammaproteobacteria.fasta
• http://kodomo.cmm.msu.ru/~ramil.mintaev/projects/files/otbr_gomologi.txt
• http://kodomo.cmm.msu.ru/~alisikfox90/term2/all.fasta

. Название публикации . Kinase related protein/telokin inhibits microcystin-induced Ca2+-independent contraction in triton skinned guinea pig taenia coli . Авторы . O. Shcherbakova, D. Serebryanaya, A. Postnikov, S. Zittrich, V. Shirinsky, A. Vorotnikov, G. Pfitzer . Дата . 31.12.2009 23:00:00 . Название журнала . Biochem. J. Том . Vol.429. Номер . 2 . первая страница . 291 . последняя страница . 302. Купить нет на складе . 2009 ФФМ МГУ, 2009

Еще в разделе: (Показать все результаты (>5) - fbm.msu.ru/ )

... 2015 . ... The article is dedicated to the analysis of the experience of risk management implementation in public administration of Great Britain, Canada, and the United States of America. ... It is emphasized that risk management implementation in public management activities needs changing the organizational culture of the state bodies, application change management tools, and development a clear methodical guide to implementation of this methodology. ... Public Administrarion". ...

Еще в разделе: (Показать все результаты (>114) - ee-journal.spa.msu.ru/ )