Dynamite . Dynamite is a code generating language developed for sequence comparison methods. ... Dynamite is a way of automatically making these algorithms. ... http://www.sanger.ac.uk/Software/Dynamite/ . Source Code Availability: Yes . ... ftp://ftp.sanger.ac.uk/pub/birney/dynamite/ (FTP Site) . ... dynamite@sanger.ac.uk (mailing list) . User Comments: . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . Comments? ... Copyright 1995-2001 by Herng-Jeng Jou . ...

Еще в разделе: (Показать все результаты (>3189) - www.sai.msu.su/ )

• SAL- Parallel Computing - Programming Languages Systems - esep
• APOD: 2011 February 22 - Star Size Comparisons
• APOD: 2013 June 6 - Star Size Comparisons

... The main problem is increasing the recognition rate of some recognition engines, working in some restricted domains, such as telephone time-table question-answer systems and so on. ... Our algorithms allow user to get recognition variants, which are right sentences in some formal language. ... We suppose that BRE can produce a set of recognition variants in the form of the "complex chain". ... Length of complex chain is the number of vertexes in its graph. ... const*n^2 . ...

Еще в разделе: (Показать все результаты (>94) - www.intsys.msu.ru/ )

... We have recently provided detailed insight into structural aspects and chemical behaviour of several alkali-metal acylpyrazolonato systems. Here we extend our study on the interaction of these donors toward zinc(II) and cadmium(II) acceptors in the presence of several mono- and bidentate ancillary ligands. Hydrated or solvated bis(acylpyrazolonate)metal derivatives can be readily obtained, which are stabilized in the solid state by extensive intermolecular H-bonding. ...

Еще в разделе: (Показать все результаты (>568) - chem.msu.ru/ )

• Conjunction of thermal lens spectrometry and high-performance liquid
• A comparison of the infrared multiphoton dissociation of C3H5C(CH3)3 and
• Determination of Reaction Rate Constants in Micelles. A Comparison of the

COMPARISON OF CLUSTERING ALGORITHMS FOR SPEAKER IDENTIFICATION Nikolay Lubimov, Evgeny Mikheev, Alexey Lukin Moscow Lomonosov State University, Moscow, Russia In this paper we consider the problem of text-independent speaker identification that refers to acoustic recognition research. ... We have performed the comparison of different clustering methods for speaker identification: the standard K-means clustering, K-means++, Linde-Buzo-Gray, Fuzzy C-means, and Gustafson-Kessel algorithms. ...

Еще в разделе: (Показать все результаты (>278) - imaging.cmc.msu.ru/ )

• Image sharpening by grid warping | Laboratory of Mathematical Methods of Image
• View publication | Laboratory of Mathematical Methods of Image Processing
• Ringing effect modeling | Laboratory of Mathematical Methods of Image...

... Search for Single Top Quark Production at DZero using Neural Networks" . ... Search for Single Top Quark Production at D0 Using Neural Networks" . ... Search for Electroweak Production of Single Top Quarks" . ... Use of Neural Networks in a Search for Single Top Quark Production at D0", . ... Search for Single Top Quark Production at the Tevatron" . ... Use of Neural Networks in a Search for Single Top Quark Production with the DZero Detector at the Fermilab Tevatron Collider", . ...

Еще в разделе: (Показать все результаты (>8) - top.sinp.msu.ru/ )

COBORDISMS AND FINITE GROUP ACTIONS IN THE WORK OF TARAS PANOV In works of T. Panov [5]ґ[7] the cobordism theory and formal group laws are applied to the study of the fixed point sets of Z/p-actions. Characteristic classes and cob ordisms of manifolds with simple Z/p-action. A Z/p-action on a manifold M is called simple if all connected components of the fixed point set have trivial normal bundle. ... El liptic genus for manifolds with an action of the group Z/p. Russian Math. ...

Еще в разделе: (Показать все результаты (>95) - higeom.math.msu.su/ )

... If you're interested in a complex command with lots of options, rpm -e is not the place to look. ... If you're a bit gun-shy about erasing a package, you can use the --test option first to see what rpm -e would do: . rpm -e --test bother removing these packages would break dependencies: bother >= 3.1 is needed by blather-7.9-1 # . ... In the section called Getting More Information With -vv , we used the -vv option to see what RPM was actually doing when it erased a package. ... Erasing a Package . ...

Еще в разделе: (Показать все результаты (>233) - uneex.lorien.cs.msu.su/ )

• SSL/TLS Strong Encryption: Compatibility - Apache HTTP Server
• HelpOnTables - UNИX
• HelpOnImages - UNИX

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/mol_biol_mosk_2006.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

.

Еще в разделе: (Показать все результаты (>39) - comet.sai.msu.ru/ )

• Astronomical Circular - Contents

... CPALGS ] Popov, V., Kurepkin, I., and S. Leontiev, "Additional Cryptographic Algorithms for Use with GOST 28147-89, GOST R 34.10-94, GOST R 34.10-2001, and GOST R 34.11-94 Algorithms", RFC 4357 , January 2006; . ... CPCMS ] Leontiev, S. and G. Chudov, "Using the GOST 28147-89, GOST R 34.11-94, GOST R 34.10-94, and GOST R 34.10-2001 Algorithms with Cryptographic Message Syntax (CMS)", RFC 4490 , May 2006; . ...

Еще в разделе: (Показать все результаты (>132) - lnfm1.sai.msu.ru/ )

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > SSL/TLS . ... Here we talk about backward compatibility to other SSL solutions. ... Currently full backward compatibility is provided only for Apache-SSL 1.x and mod_ssl 2.0.x. Compatibility to Sioux 1.x and Stronghold 2.x is only partial because of special functionality in these interfaces which mod_ssl (still) doesn't provide. ... Apache-SSL 1.x & mod_ssl 2.0.x compatibility: . ... SSL_STRONG_CRYPTO . ...

Еще в разделе: (Показать все результаты (>190) - itpm.msu.su/ )

• Starting Apache - Apache HTTP Server
• Linux Administration Made Easy: Help! Trouble in Paradise!
• Alignment, font styles, and horizontal rules in HTML documents

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>87) - uneex.mithril.cs.msu.su/ )

• HelpOnImages - UNИX
• HelpOnInstalling/MinimalWiki - UNИX
• Index of /static/WikipediaEn_CmfComparison/cmf_comparison.en_files

Number of cores used . ... Standard MP4(SDTQ) benchmark, Wall clock time and relative speedup . ... Intel Quad Core 2.83 GHz Q9550 CPU on an Asus P5Q board (Intel P45 chipset), 4x4 GB DDR-2 800 MHz RAM (total 16 GB), 2x 640 GB Samsung SATA-2 hard disks configured as software RAID-0, Linux Opensuse 64-bit kernel 2.6.25.18-0.2-default. ... Harpertown performance comparison page . ... Press to visit PC GAMESS v. 7.1 performance and scalability on 16-core Intel Tigerton (Xeon X7350)-based system page . ...

Еще в разделе: (Показать все результаты (>83) - classic.chem.msu.su/ )

• PC GAMESS scalability: comparison of dynamic vs static load balancing on
• PC GAMESS vs. WinGamess performance comparison
• PC GAMESS v. 7.0.4: Opteron Rev. E vs. Opteron Rev. F performance comparison

Lomonosov Moscow State University . ... Divisions and Departments . Academic Programs . ... International Cooperation . ... Academic Departments Programs . ... International Studies . ... Additional Training Opportunities . ... Bulletin of Moscow University . ... Faculty of Foreign Languages and Area Studies Lomonosov Moscow State University: . 119192, Russia, Moscow, Lomonosov Str., ... 2000 - 2016 Faculty of Foreign Languages and Area Studies Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>90) - ffl.msu.ru/ )

• Site map
• Faculty of Foreign Languages and Area Studies
• About Us

install ]] . ... Installation of a user directory . ... Below, we use the following notations: XXXX - CompHEP version number; comphep-XXXX - directory where CompHEP files will live; comphep-XXXX.tgz - distributive tar-file with sources; comphep-XXXX-linux.tgz - distributive tar-file with binaries; . ... The directory with name comphep-XXXX will be created with all files of CompHEP distributive. ... In order to create a user working directory execute: make setup WDIR=path_to_user_work_directory . ...

Еще в разделе: (Показать все результаты (>7) - comphep.sinp.msu.ru/ )

RIDGE AND TREE FEATURE DETECTION ON IMAGES A. Levashov 2, D. Yurin3 2, 3 1 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia 2 alexeylevashov89@gmail.com , 3yurin@cs.msu.ru In this article a new ridge detector with improved non-maxima suppression procedure in scale-space is proposed. ... The algorithm is tested on synthetic, landscape and medical images. ...

Еще в разделе: (Показать все результаты (>11) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2013.PRIA.Mamaev_Lukin_Yurin.HermiteNLM.en.pdf

Starting Apache on Windows . Starting Apache on Unix . ... If the Port specified in the configuration file is the default of 80 (or any other port below 1024), then it is necessary to have root privileges in order to start Apache, so that it can bind to this privileged port. ... As an alternative to invoking the httpd binary directly, a shell script called apachectl is provided which can be used to control the daemon process with simple commands such as apachectl start and apachectl stop . ...

Еще в разделе: (Показать все результаты (>60) - neptun.sai.msu.ru/ )

• Apache module mod_isapi
• Apache Tutorial: Introduction to Server Side Includes
• Custom error responses

Execution performance of NAS tests . The tables, presented below, contain information about sizes and performance of MPI-programs and DVM-programs for NAS tests. ... Performances of DVM-programs and MPI-programs are comparable. ... Second, MPI-versions of some tests use parallelization along two dimensions of processor grid, whereas DVM-versions of all tests are performed now only on a line of processors. ... RCC-cluster Pentium III/500 + SCI, . ... BT test execution times in seconds (class A) . ...

Еще в разделе: (Показать все результаты (>94) - sp.cs.msu.ru/ )

• Темы докладов, курсовых и дипломных работ. 1998-1999 учебный год
• Fortran DVM language description. Part 1 (1-4)

... Comparison of soluble and placental transferrin receptors as standards for the determination of soluble transferrin receptor in humans. ... 1500 kDa, whereas the MW of sTfR corresponded to 237 kDa. ... The serum sTfR levels calculated against sTfR were 2.5 times lower than those calculated against pTfR. Serum sTfR levels are overestimated when pTfR is used as the standard. ...

Еще в разделе: (Показать все результаты (>38) - biochem.bio.msu.ru/ )

• Sperm-specific glyceraldehyde-3-phosphate dehydrogenase is stabilized by

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>99) - vestnik.math.msu.su/ )