Next: Critical Frequencies and Gravitational Previous: Extragalactic Gravitational Wave Background . The number of binaries per frequency decade per solid angle from a separate stellar system (galaxy or cluster of galaxies) is . ... For example, for the Andromeda galaxy M31 ( rad, ) one gets . ... If the angular size of the galaxy is less than the angular resolution of the detector, the critical frequency is independent of the angular resolution, . ...

Еще в разделе: (Показать все результаты (>514) - xray.sai.msu.ru/ )

... An array in PHP is actually an ordered map. ... The array type in PHP is very versatile, so here will be some examples to show you the full power of arrays . // this $a = array ( ' color ' = 'red' , 'taste' = 'sweet' , 'shape' = 'round' , 'name' = 'apple' , 4 // key will be 0 ); // is completely equivalent with $a[' color '] = 'red'; $a['taste'] = 'sweet'; $a['shape'] = 'round'; $a['name'] = 'apple'; $a[] = 4; // key will be 0 $b[] = 'a'; $b[] = 'b'; $b[] = 'c'; // will result in the ...

Еще в разделе: (Показать все результаты (>937) - oit.cmc.msu.ru/ )

• Comments
• Extending PHP 4.0
• Duplicating Variable Contents: The Copy Constructor

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>17) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Alignment example
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... Why do I see a string of "X"s (or "N"s) in my query sequence that I did not put there? ... BLAST (Basic Local Alignment Search Tool) is a set of similarity search programs designed to explore all of the available sequence databases regardless of whether the query is protein or DNA. ... Filters are used to remove low-complexity sequence because it can cause artifactual hits (please see Q: After running a search why do I see a string of "X"s (or "N"s) in my query sequence that I did not put there? ...

Еще в разделе: (Показать все результаты (>126) - www.genebee.msu.ru/ )

• Genebee BLAST 2.2.8 Services Help
• Genebee BLAST 2.2.22+ Services Help

For separation of anisotropy and inhomogeneity influence we recommend non-symmetrical rotation of arrays (for example, to rotate the D - array around the center of AB (or MN), instead of spacing center) and analysis of azimuthal diagrams' spectrum (Bolshakov et al., ... Dipole equatorial array is not so convenient for asymmetrical rotation, at which one dipole is gone along a circle’s arch, while other dipole turns around its center. ...

Еще в разделе: (Показать все результаты (>58) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

... An event inexplicable by the laws of nature; a miracle. ... A good title for the workshop · Dark matter came as a surprise, · A strong emotion is associated with the awareness that we seem to know the basic laws of nature but we still miss... what is the universe made of.. Raises doubts on our understanding of early universe · Its discovery may need a monumental effort · BUT, hopefully it CAN be explained by the laws of nature Progress on DM · Evidence from Dama/Lybra .. ...

Еще в разделе: (Показать все результаты (>141) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/210809/Panov.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/200809/Stodolsky_nuta.pdf

... For the past years I have been working on the problem of synthesis of light curves of close binary systems, consisting of a normal star and a compact object (point object with fixed X-ray luminosity). ... Possible existence of a bright spot on the disk's lateral surface is taken into account. ... The last of then will be published in Gordon and Breach Publishers ( Cherepashchuk A.M., Katysheva N.A., Khruzina T.S., Shugarov S.Yu. ... Cherepashchuk A.M., Katysheva N.A., Khruzina T.S., Shugarov S.Yu. ...

Еще в разделе: (Показать все результаты (>10) - uranus.sai.msu.ru/ )

pic] European Commission - Press release E7 billion boost for research and innovation will create jobs and growth Brussels, 19 July 2011 - Today Commissioner MАire Geoghegan-Quinn announced nearly E7 billion to kick-start innovation through research. ... Today, Europe is again showing its commitment to putting research and innovation at the top of the political agenda for growth and jobs. ... Research and innovation for cleaner, safer and more efficient transport and mobility will get E313 million. ...

Еще в разделе: (Показать все результаты (>34) - ideas.msu.ru/ )

Network Working Group Request for Comments: 617 NIC #21771 Edward Taft (PARC-MAXC) Feb 1974 A Note on Socket Number Assignment 2 INTRODUCTION In several current and proposed protocols, as well as other documents, the assumption is made (or implied) process in control of one end of a Telnet connection access to a group of socket numbers beginning with or the Telnet socket numbers. in a few that a ... As a function of the user identification, making a "user-relative" socket. ...

Еще в разделе: (Показать все результаты (>20571) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc617.txt
• http://mirror.msu.net/pub/gentoo-portage/dev-python/llvmlite/llvmlite-0.6.0.ebuild
• http://mirror.msu.net/pub/gentoo-portage/dev-python/llvmlite/llvmlite-0.10.0.ebuild

... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...

Еще в разделе: (Показать все результаты (>4) - oc.cs.msu.ru/ )

... Solar Data: f.e. X-ray . Night Sky Live . ... Heavens-Above: Sky chart, Satellites, Iridiums and astronomical objects For Moscow For SAO Baksan . ... ESO-MIDAS page . ... Tutorials for Astronomy . ... Asteroid and Comet Hazard . ... Observable Comets: This page lists links to orbital elements and ephemerides of (potentially) observable comets. ... Leonid page - a lot of information for years Comets and Meteor Showers . The American Meteor Society . ... North American Meteor Network Home Page . ...

Еще в разделе: (Показать все результаты (>22) - astrometric.sai.msu.ru/ )

... Modulation Spaces, Appropriate Spaces to Have in Background? ... Modulation spaces were introduced in 1983 as a certain type of Wiener-Amalgam spaces. One found that they are in particularily convenient to have in background when dealing with time-frequency analysis, especially signals in general. ... In 1994 one found that they are sometimes appropriate spaces when dealing with certain non-regularity problems in pseudo-differential calculus. ... We discus general phenomena for modulation spaces. ...

Еще в разделе: (Показать все результаты (>91) - acs366.phys.msu.su/ )

... Added sandbox example editor for py3k+ttk . ... line source . ... 6 def __init__ ( self , * args , ** kw ): . ... init__ ( self , * args , ** kw ) . ... 12 def attach ( self , widget ): . ... 15 widget [ command ] = lambda * args , ** kw : self . ... 17 def _command ( self , * args , ** kw ): . ... 24 def _set ( self , sender , * args , ** kw ): . ... 41 def tag_clear ( self , tag ): . ... 47 def insert ( self , * args , ** kw ): . ... 53 def _select ( self , ev ): . ... 79 names . ... 80 sequences ...

Еще в разделе: (Показать все результаты (>12236) - kodomo.fbb.msu.ru/ )

• allpy: ef6692b5ffbc
• allpy: 7ef0081ffd9c sandbox/ttk.py
• allpy: 208ec59bad5b sandbox/ttk.py

RIDGE AND TREE FEATURE DETECTION ON IMAGES A. Levashov 2, D. Yurin3 2, 3 1 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia 2 alexeylevashov89@gmail.com , 3yurin@cs.msu.ru In this article a new ridge detector with improved non-maxima suppression procedure in scale-space is proposed. ... The algorithm is tested on synthetic, landscape and medical images. ...

Еще в разделе: (Показать все результаты (>8) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2013.PRIA.Mamaev_Lukin_Yurin.HermiteNLM.en.pdf

... My presentation mainly based on the experience I gained working as a co-ordinator of the Caucasus NGOs Forum in 1999 - 2000. ... The Forum is an example of an NGO network for conflict transformation. ... This is exacerbated by the fact that the Forum is a cross-conflict, cross-border, cross-cultural initiative, whereas most of the funders who support NGO work develop separate programmes for different states and even regions in the former Soviet Union. ... His work is based on the tenet "do no harm"....

Еще в разделе: (Показать все результаты (>106) - www.prof.msu.ru/ )

• About the importance of founding teleecommunication centres in developing areas
• I GAINED WORKING AS A COORDINATOR OF THE CAUCASUS NGOS FORUM
• Commemoration of the centenary of Senator Fulbright's birth

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

VIEWS Paul Murdin M T Wright Data, information and science I was one of almost half the IAU General Assembly that voted against the IAU resolution initiated by Elizabeth Griffin in Manchester in August 2000. ... The IUE archive, for example, delivers ultraviolet spectra into the hands of the community at the same rate that the satellite itself used to do, and papers frequently appear that are based on the archive. Other space missions like ISO and XMM have and are completing similar archives. ...

Еще в разделе: (Показать все результаты (>81) - hbar.phys.msu.ru/ )

• Ответ Wally на книгу "Крах С14"

fitshdr_edit - FITS-file headers interactive editor fitshdr_edit [options] FITSfile_name . fitshdr_edit utility allows to modify FITS headers' lines interactively (FITS MultiExtentionsFiles included). fitshdr_edit is just simple shell script around fitshdr utility. ... It means, that You can't remove line from header! ... 560:CRDELT2 = 21.0 / this is example 640: 720:HISTORY header No.0: 1st history line 123456789012345678901234567 880:COMMENT Sat Sep 25 21:17:34 CEST 2004 / by fitshdr_edit . ...

Еще в разделе: (Показать все результаты (>162) - lnfm1.sai.msu.ru/ )

• Manpage of FITSHDR
• IDL programs
• FITShdr: INSTALL

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>137) - bioinf.fbb.msu.ru/ )

• SDPsite - Gallery of examples
• SDPpred
• Alignment example

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>21) - tukachev.flogiston.ru/ )

• Category: Новости