... О UNИX . ... ExportDump . ... Example with --page parameter using regular expression . Output . ... Known limitations "moin export dump" is an HTML export utility to create static HTML dumps of wiki content. ... The --page parameter is optional and will dump pages matching the pagename. ... With the parameter, the output is limited by ACL rules to pages that can be read by the username. ... Note the --page , --target-dir , and --username parameters must follow the export dump parameters. ...

Еще в разделе: (Показать все результаты (>216) - uneex.mithril.cs.msu.su/ )

• HelpOnConfiguration/IntegratingWithApache - UNИX
• LecturesCMC/PythonIntro2014/06_FilesModulesSystem/Examples - UNИX
• Index of /static/GimpDoc_EnRu/images/dialogs/examples

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>22) - mouse.belozersky.msu.ru/ )

• Alignment example
• Example of alignment
• 1QPI biounits

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>50) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>59) - tukachev.flogiston.ru/ )

• Category: Новости

... Previous message: [Comphep-common] How to export plot table in numerical batch mode . ... Dear Sasha and Lev, insofar as one and the same question (see below) arises rather frequently, could you please describe possible variants how to split event file or HEP Ntuple on the CompHEP page in the section FAQ? http://comphep.sinp.msu.ru Yours M.D. -- шБ ---------- Forwarded message ---------- Dear Dmitri.Konstantinov, Please, I have a question about CompHEPInterface in CMSSW. ...

Еще в разделе: (Показать все результаты (>856) - theory.sinp.msu.ru/ )

• fc3:dokuwiki:example [THEP]
• Examples
• Example: Summation of diagrams and symbolic integration by means of the Reduce

... Monday, July 5th, 2010 . ... http://img-fotki NULL .yandex NULL .ru/get/5102/mironyc NULL .3f/0_2b1a9_24ed0749_XL NULL .jpg) . ... Posted in Uncategorized | ... На сайт добавлен пакет Lightbox 2.04 (http://www NULL .huddletogether NULL .com/projects/lightbox2/) (by Lokesh Dhakar) для отображения графики с дополнительными визуальными эффектами: . ... Наши публикации . ... Публикации за 2011 . Публикации за 2012 . ... Лаборатория лазерной интерферометрии is proudly powered by WordPress . ...

Еще в разделе: (Показать все результаты (>46) - geo.sai.msu.ru/ )

• Lightbox 2 Лаборатория лазерной интерферометрии
• June 2010 Лаборатория лазерной интерферометрии
• site lightbox Лаборатория лазерной интерферометрии

... Научные семинары . ... расписание семинаров . семинар 1 . ... Отчет о семинаре || ... This talk will focus on one of the emerging technology for solar light conversion into electricity; the dye-sensitized solar cell. ... The present lecture will give a general background to the solar energy field with a focus on dye-sensitized solar cells. ... С докладом Dye-sensitized Solar Cells Materials and Interfaces выступил профессор Lars Kloo из Королевского технологического института г. Стокгольма. ...

Еще в разделе: (Показать все результаты (>8) - nano.msu.ru/ )

• Dye-sensitized Solar Cells ? Materials and Interfaces | MSU Nanotechnology

Using stand-alone SDPfox . ... To add a new specificity group, type in the group name and press "Add" . To change composition of specificity groups, select two groups: first, from which to remove sequences, and second, to which to add sequences. ... For a constructed grouping, it is possible to run SDPgroup, re-randomize grouping or move sequences according to the best weights (see algorithm) under the link 'SDPgroup'. ... These sequences are likely to be re-grouped after SDPgroup is performed. ...

Еще в разделе: (Показать все результаты (>136) - bioinf.fbb.msu.ru/ )

• SDPsite - Gallery of examples
• Alignment example
• User's guide

... For those who is interested in thermodynamic modeling . Yuri Shvarov . This page is aimed mainly at the users of the software package HCh for thermodynamic (equilibrium) modeling of (geo)chemical systems and processes. However, some files presented here may also be of some interest to those who do not use HCh. ... HCh for DOS . ... User's guide for the Unitherm program intended for maintaining thermodynamic databases and calculation of thermodynamic properties of substances . ...

Еще в разделе: (Показать все результаты (>32) - www.geol.msu.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... Posted by Peter Mamonov in Без рубрики . ... ab initio basis sets cp2k education Firefly FRAP GAMESS gromacs MDAnalysis membrane mmb nano OPLS pymol python scipy sparse matrix toolset topology познавательно учебные материалы . OPLS-AA patch for different types of molecules . ... All-atom automatic OPLS-AA topology generator . ... OPLS-AA? in All-atom automatic OPLS-AA topology? ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>25) - erg.biophys.msu.ru/ )

... Numeration assumed . ... All contacts alignment . ... For this study 20 PDB-entries containing coordinates of ETS domains were used. These entries represent 10 proteins from two species: Homo sapiens and Mus musculus . ... X-ray . ... Yes . ... Homo sapiens . ... ETS-1 . ... The sequence alignment of all studied ETS domains . ... The alignment obtained reveals the conservative trinucleotide core GGA , which is recognized by ETS domain and is usually called EBS (ETS Binding Site). ...

Еще в разделе: (Показать все результаты (>809) - monkey.belozersky.msu.ru/ )

• Example of supporting positions
• SDP home page
• SCOP famyli:

... Tue, 07 Dec 2010 12:55:31 GMT Ilia [56:df6c4316ca72] * Interface.py ( modified ) add scrollbar to listbox Tue, 07 Dec 2010 11:14:03 GMT Ilia [55:bf831181327c] * Interface.py ( modified ) make of window Tue, 07 Dec 2010 00:03:18 GMT is_rusinov [54:cd1c0983d3b6] * Interface.py ( modified ) mouse handlers, change state, still there are mistakes in these methods Mon, 06 Dec ...

Еще в разделе: (Показать все результаты (>777) - kodomo.cmm.msu.su/ )

• http://kodomo.cmm.msu.su/trac/cca/log/?format=changelog&rev=58%3Add3e42d72f44&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/cca/log/?format=changelog&rev=59%3A9a80d2c6acbf&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/cca/log/?format=changelog&rev=9a80d2c6acbfc40dbf10416ee117b6f70c3cbdff&limit=100&mode=stop_on_copy

MOSCOW STATE UNIVERSITY -- Faculty of Biology -- Department of Human Physiology -- . ... Our interest is the secret springs of work of a brain. How can a new idea be born in the brain if the physical environment remains constant? ... What mechanisms of the brain are broken in schizophrenia? ... For this purpose we create brain-computer interfaces (BCI) based on modern methods of computational electroencephalography. ... Department of Human Physiology . ... Former Visitors . ... Former students . ...

Еще в разделе: (Показать все результаты (>52) - brain.bio.msu.ru/ )

• Links -- Laboratory for Neurophysiology and Neuro-Computer Interfaces (MSU,
• Patents -- Laboratory for Neurophysiology and Neuro-Computer Interfaces
• Sergei Shishkin * Сергей Шишкин

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>46) - hist.msu.ru/ )

... Interface description . ... 6 Distributed array creating and deleting . ... 13.4 Access to elements of local part of distributed array . 13.4.1 Requesting if array element is allocated in local part of distributed array . ... 13.4.5 Coping element of local part of distributed array to element of local part of other distributed array . 13.4.6 Requesting address of element of local part of distributed array . ... 14.5 Access to distributed array elements, allocated in remote element buffer . ...

Еще в разделе: (Показать все результаты (>118) - sp.cs.msu.ru/ )

• Fortran DVM language description
• Lib-DVM. Interface description. Part 7 (19)
• C-DVM language description

Starting from the PC GAMESS version 6.3, the support of the new proprietary parallel mode communication interface (which is called P2P interface) was implemented as the part of PC GAMESS. ... The PC GAMESS/Firefly specific parallel MP2 energy and energy gradient method=1 modules supports P2P communication model. ... The dynamic library in which the P2P interface is implemented. ... Starting from the PC GAMESS v. 6.4, the DLB (dynamic load balancing) functionality was added to P2P interface. ...

Еще в разделе: (Показать все результаты (>92) - classic.chem.msu.su/ )

• PC GAMESS/Firefly DOCUMENTATION - running in parallel using LAM/MPI
• Lesson 3: two methods for preparing Firefly' input files with basis sets and
• PC GAMESS/Firefly DOCUMENTATION - running in parallel under Windows using WMPI

... Войти в систему . ... Другие названия журнала: J Colloid Interface Sci , J. Coll. ... Interface Science показать полностью.. J. Colloid Interface Sci , J. Colloid and Interface Science , J. of Colloid and Interface Science , J.Coll.Int.Sci , J.Colloid Interface Sci . ... Drozdova O.Yu , Pokrovsky O.S. , Lapitskiy S.A. , Shirokova L.S. , Gonz?lez A.G., Demin V.V. в журнале Journal of Colloid and Interface Science , издательство Academic Press (United States) , ? ...

Еще в разделе: (Показать все результаты (>635) - istina.msu.ru/ )

• ACS applied materials & interfaces - журнал | ИСТИНА - Интеллектуальная Система
• Surface and Interface Analysis - журнал | ИСТИНА - Интеллектуальная Система
• Advances in Colloid and Interface Science - журнал | ИСТИНА - Интеллектуальная

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>20) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Nucleus Ground State Parameters
• CDFE => Online Services => NSR Search Engine
• CDFE provides the major photonuclear databases. Online Services.

... They in fact form surfaces that can be treated as interfaces between polar aqueous solutions and non-polar environment of phospholipidic side chains. ... That's why our idea was to study the behaviour of amino acid residues, as monomer units of proteins, in an interfacial system. Objective By means of molecular dynamics simulations we intended to study the properties of amino acid residues in a system containing liquid-liquid interface between water and hexane, which we took as a non-polar phase. ...

Еще в разделе: (Показать все результаты (>121) - polly.phys.msu.ru/ )

• Polymer Macromolecules at Surfaces, Polymer Interfaces (theory + computer
• Polymer and Soft Matter Theory Lab - Official Website