... Devitrification of glass with the cation ratio, corresponding to the {Bi2.18Sr2CaCu2Ox+0.4Sr1.7Ca1.3Al2O6} composition, was studied. ... Above 600 o C, Bi-2212 and (Sr,Ca)3Al2O6 formed simultaneously, so that at 750 o C, the two-phase composite Bi-2212 - (Sr,Ca)3Al2O6 was obtained that contained grains of the aluminate phase 0.03-0.3 micron in size. ...

Еще в разделе: (Показать все результаты (>114) - chem.msu.ru/ )

Mathematical modeling of the 3D evolution problem for the interface between liquids of different viscosity and density in a uniform and infinite soil" . Nikolsky D.N. The three-dimensional evolution problem for the interface between liquids of different viscosity and density is formulated for the case of piston displacement. ...

Еще в разделе: (Показать все результаты (>56) - num-meth.srcc.msu.ru/ )

• "The Fortran programming language evolution (1957-2007) and the prospects of
• "Modeling of magnetorotational instability evolution using a parallel RKDG
• "Discretization of Navier-Stokes equations on moving unstructured meshes"

Катрич Н.С. The evolution of phylogenetic system and ecology // E-Conference Evolution and Biodiversity: The evolutionary basis of biodiversity and its potential for adaptation to global change 1st 19th March 2010 (электронная конференция: http://win.mail.ru/cgi-bin/msglist?folder=0 2145270639#/cgi-bin/readmsg_Q_id=1269011137000000027 8 =0 . ...

Еще в разделе: (Показать все результаты (>51) - srcc.msu.ru/ )

• T.G.Arshakian, R.Beck, M.Krause, D.Sokoloff Evolution of magnetic fields in
• D.Sokoloff, Galaxy formation and evolution by Houjun Mo, Frank van den Bosch
• D.Sokoloff Galaxy formation and evolution by Houjun Mo, Frank van den Bosch and

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>1124) - kodomo.cmm.msu.ru/ )

• Practice1(evolution)
• evolution
• Gene Evolution Reconstruction

A very important stage in a story of formation of any new science is the shift from discussion of situation which are possible but do not occur in practice due to some reason to recognition of real phenomena of interest. ... We suggest to consider computer viruses as this new specific form of life which is coming in the contact with our form of life. ... Computer life has been created by human being, the role of independent evolution of computer viruses seems to be still negligible. ...

Еще в разделе: (Показать все результаты (>144) - lnfm1.sai.msu.ru/ )

• Division of the Galaxy and Variable Stars
• Публикации Н.А.Соловой

... G. A Leikin, A. N. Sanovich. Sternberg Astronomical Institute, Moscow 119899, Russia. Brown University - Vernadsky Institute Microsymposium 34, October 8-9, 2001, Moscow, Russia . ... G. A. Leikin and A. N. Sanovich, Sternberg State Astronomical Institute, Moscow State University, . ... Brown University - Vernadsky Institute Microsymposium 38, October 27-29, 2003, Moscow, Russia . ... Sternberg State Astronomical Institute, Moscow, State University, 119992, Moscow, Universitetskij prosp. ...

Еще в разделе: (Показать все результаты (>61) - selena.sai.msu.ru/ )

• Anatoly N. Sanovich

Кафедра Общей Физики и Волновых Процессов . физического факультета МГУ . Главная . ... О Кафедре . Наука и учеба . ... Публикации . Лаборатории . ... Наука . ... 18.03.2016 . Открыт прием заявок на участие студентов в Универсиаде "Ломоносов" . ... Главная Наука и учеба Публикации . ... Абстракт: The most general approaches to determining the quantitative measure of quantum information are analyzed based on physical content. ... 2009 Кафедра ОФиВП, физический факультет МГУ . ...

Еще в разделе: (Показать все результаты (>30) - ofvp.phys.msu.ru/ )

. The Linux System Administrators' Guide . Prev . Next . The source code and and other machine readable formats of this book can be found on the Internet via anonymous FTP at the Linux Documentation Project home page http://sunsite.unc.edu/LDP/ , or at the home page of this book at http://www.iki.fi/liw/linux/sag/ . Available are at least PostScript and TeX .DVI formats. Prev . Home . Next . Dedication . Introduction

Еще в разделе: (Показать все результаты (>384) - itpm.msu.su/ )

• mod_auth_anon - Apache HTTP Server
• SSL/TLS Strong Encryption: Compatibility - Apache HTTP Server
• Directive Index - Apache HTTP Server

Международный учебно-научный лазерный центр МГУ им. М.В. Ломоносова . Главная . ... О МЛЦ МГУ . Наука . ... Публикации . ... 10.10.2015 . ... Главная Публикации . ... Опубликовано: Laser Physics, 13(10), 1-5 . ... Абстракт: The most general approaches to determining the quantitative measure of quantum information are analyzed based on physical content. Dynamic information is proposed as an alternative to coherent information. ... 2008 МЛЦ МГУ . ...

Еще в разделе: (Показать все результаты (>23) - ilc.phys.msu.ru/ )

CALCULATION OF THE PARAMETERS OF MICROSCOPIC OPTICAL POTENTIAL BY ASYNCHRONOUS DIFFERENTIAL EVOLUTION ALGORITHM Zhabitskaya E.I ., Zhabitsky M.V.1 , Zemlyanaya E.V., Lukyanov K.V. Dubna University, Russi, Dubn; Joint Institute for Nuclear Research, LIT, Russia, Dubna ,141980, Joliot-Curie 6 Joint Institute for Nuclear Research, LNP, Russia, Dubna ,141980, Joliot-Curie 6; Rock Flow Dynamics, Russi, Moscow 1 Differential ... J. of Global Optimization 11,1997, Pp. ...

Еще в разделе: (Показать все результаты (>44) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc150820/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc98332/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc27224/doc.pdf

... Эволюция Афгано-Таджикской депрессии: . от задугового бассейна до транспрессивного складчатого сооружения . ... Наиболее вероятно, что высокие скорости порождаются присутствием на глубине океанской коры. ... В это время происходит морфологическое оформление дуги поднятий ЮЗ Гиссара - Южного Гиссара на фоне интенсивного утонения коры и прогибания в области собственно Таджикской депрессии; в целом задуговый бассейн приобретает отчетливое сходство с такой структурой как Паннонская впадина. ...

Еще в разделе: (Показать все результаты (>371) - geo.web.ru/ )

• Геодинамическая и тектоническая эволюция Карпатской дуги и ее форланда
• Modes of transform faults evolution
• Informal geological society (RSG SG )

Rare amino acid changes fixation drives divergence in Metazoa evolution K.V. Gunbin, V.V. Suslov, Y.L. Orlov Institute of Cytology and Genetics SB RAS, Novosibirsk, Russia , genkvg@gmail.com Novosibirsk State University, Novosibirsk, Russia One of the features of the molecular evolution of any amino acid sequence is an unevenness of the rates of mutation accumulation. ... Mutation bursts usually are accompanied by the fixation of statistically rare amino acid substitutions [2, 3]. ...

Еще в разделе: (Показать все результаты (>155) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/30.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/210.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/107.pdf

New tests for high energy factorization in Drell-Yan lepton pair production Nikolay P. Zotov SINP MSU, Moscow, Russia in collaboration with S.P. Baranov, A.V. Lipatov N.P . Zotov QFTHEP 2013 , St. Petersburg , Russia , June 24, 2013 Content Introduction Theoretical framework - off-shell amplidudes - unintegrated ( TMD ) parton densities Numerical results Conclusions N.P . Zotov QFTHEP 2013 , St ...

Еще в разделе: (Показать все результаты (>72) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/QFTHEP2010Dolgopolov.pdf
• http://qfthep.sinp.msu.ru/talks/qfthep2010_dubinin.pdf
• http://qfthep.sinp.msu.ru/talks2013/shleenkov.pdf

Tachyoryctes splendens . Genetic and cytogenetic variation of African root-rats Tachyoryctes splendens (Mammalia: Rodentia) from Ethiopia . ... Genetic and cytogenetic variation of African root-rats Tachyoryctes splendens sensu lato from Ethiopia was assessed on 23 complete cytochrome b gene sequences (1140 bp) and chromosomal sets from eight individuals. ... Notes on the karyotype of Tachyoryctes splendens (RГ?ppel 1836) (Rodentia, Rhizomyidae) from Ethiopia // Tropical Zoology. ...

Еще в разделе: (Показать все результаты (>977) - zmmu.msu.ru/ )

• The в??developmental conduitв?? of the tribe Microtini (Rodentia, Arvicolinae):
• DNA polymorphism within Sorex araneus from European Russia as inferred from
• Little genetic divergence of the greater horseshoe bat Rhinolophus

... 2015 . ... Graduate student, Political History Department, School of Public Administration, Lomonosov Moscow State University. ... This article examines the evolution of the cadre of the regional leadership of the RSFSR in 1930 1941. The focus is on the social characteristics of the first secretaries of regional committees of the CPSU(b). ... There are two generations of first secretaries who worked in 1930 s: those who joined the office in 1917 1936, and those who did in 1937 1941. ...

Еще в разделе: (Показать все результаты (>35) - ee-journal.spa.msu.ru/ )

... Criteria of branch quality . As it was repeatedly told , phylogenetic trees consist from branches. ... I. e., those positions, which can separate sequences of the branch from other sequences in the alignment. ... Measure of branch separation . ... Here and further: A - branch of the tree, i , j - sequences of alignment . ... That's why number of conserved positions in some branch should be considered in complex with the distribution of conserved positions in the whole alignment. ...

Еще в разделе: (Показать все результаты (>28) - monkey.belozersky.msu.ru/ )

• DNA/RNA-Protein structures
• Inquiry information || Parsimony algorithm
• NPIDB

... lcn:f9 ]] . THEP . ... Show pagesource . ... Symbolic Computation in HEP . ... inSPIRE/HEP . ... Synaptics Touchpad . Проверка грамматики в Evolution . ... Чтобы исправить ситуацию, добавьте в раздел Section ?ServerLayout? для течпада Synaptics файла /etc/X11/xorg.conf строку InputDevice "Synaptics" "CorePointer" . а в раздел Section ?InputDevice? - следующие строки: Option "SHMConfig" "on" Option "TapButton1" "1" . ... Необходимо установить пакет aspell-ru yum install aspell-ru . ...

Еще в разделе: (Показать все результаты (>11085) - theory.sinp.msu.ru/ )

• lcn:centos5 [THEP]
• lcn:f10 [THEP]

FNAL SELEX experiment. ... Моя Atlas страница здесь, в МГУ. ... Страница памяти Юрия Александровича Лазарева . ... Л.Д. Ландау ? ученый, учитель, человек?(.pdf) . ... Круг Ландау: Физика войны и мира?. 2009 г., 269 стр.) ... Л.Д. Ландау?(.pdf) . 32 стр.) ... Бонсай в Москве, декабрь 2015 г. Южная Индия в январе 2011 г. Петербург в ясном октябре 2010 г. Фото на станции метро Лубянка после теракта 29 марта 2010 г. (30 марта и 6 апреля). ... Фото Гелл-Манна , выступавшего в МГУ 25.09.2007. ...

39. Russian Interdisciplinary Temporology Seminar

40. Konferences