. Subsections . Implementation of QCD Lagrangian . 3-gluon vertex. Quark-gluon interaction. Interaction of ghosts with gluon. 4-gluon interaction. Neutrino as a Majorana fermion . Leptoquarks .

Еще в разделе: (Показать все результаты (>800) - theory.sinp.msu.ru/ )

• Example: Summation of diagrams and symbolic integration by means of the Reduce
• fc3:dokuwiki:example [THEP]

... Wiki . ... wiki: InterTrac . ... An InterTrac link can be seen as a scoped TracLinks . It is used for referring to a Trac resource (Wiki page, changeset, ticket, ...) located in another Trac environment. ... If the targeted Trac is running a version below тАЛ 0.10 ( тАЛ r3526 to be precise), then it doesn't know how to dispatch an InterTrac link, and it's up to the local Trac to prepare the correct link. ... trac:wiki:InterTrac тАЛ trac:wiki:InterTrac . ... trac:ticket:234 тАЛ trac:ticket:234 . ...

Еще в разделе: (Показать все результаты (>1278) - kodomo.cmm.msu.ru/ )

• example.snake in snakes тАУ Python Battle
• WikiRestructuredTextLinks тАУ Tanchiki

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>19) - cdfe.sinp.msu.ru/ )

• CDFE provides the major photonuclear databases. Online Services.
• CDFE => Online Services => Nuclear Reaction Threshold and Energy Values

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: Gucci the The example, people really cons . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>2592) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: on the will example, refine
• Экологический Форум - Фундаментальная Экология: example, IWC such I is States.
• Экологический Форум - Фундаментальная Экология: center China. the example, the

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>17) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... О UNИX . ... Examples . ... 1 s = raw_input () 2 repeat = 0 3 for i in xrange ( 1 , len ( s )+ 1 ): 4 found = 1 5 for k in xrange ( 1 , len ( s )/ i ): 6 equal = 0 7 for j in xrange ( i ): 8 if s [ j ]== s [ j + i * k ]: 9 equal += 1 10 if equal == i : 11 found += 1 12 if found * i == len ( s ): 13 if repeat < found : 14 repeat = found 15 print repeat . ... LecturesCMC/PythonIntro2014/06_FilesModulesSystem/Examples (последним исправлял пользователь PavelSutyrin 2014-11-05 12:16:59) . ...

Еще в разделе: (Показать все результаты (>180) - uneex.mithril.cs.msu.su/ )

• Index of /static/GimpDoc_EnRu/images/dialogs/examples
• HelpOnMoinCommand/ExportDump - UNИX
• Index of /static/GimpDoc_EnRu/images/filters/examples

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>136) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide

. Name . Last modified . Size . Description . Parent Directory . - . alpha/ . 2007-02-10 22:19 . - . alpha_and_beta/ . 2007-02-10 22:19 . - . beta/ . 2007-02-10 22:19 . - . Apache/2.4.12 (Debian) Server at kodomo.fbb.msu.ru Port 80

Еще в разделе: (Показать все результаты (>5803) - kodomo.fbb.msu.ru/ )

• snake: 954cc2774637 snakes/example.snake
• allpy: 768f11381153 .geany
• allpy: .geany annotate

... Category: Standards Track December 1997 The String Representation of LDAP Search Filters 1. ... Howes Standards Track [Page 4] RFC 2254 String Representation of LDAP December 1997 If a value should contain any of the following characters Character ASCII value --------------------------- * 0x2a ( 0x28 ) 0x29 \ 0x5c NUL 0x00 the character must be encoded as the backslash '\' character (ASCII 0x5c) followed by the two hexadecimal digits representing the ASCII value of the encoded character. ...

Еще в разделе: (Показать все результаты (>18875) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc2254.txt.pdf
• http://mirror.msu.net/pub/gentoo-portage/dev-java/icu4j/icu4j-54.1.1.ebuild
• http://mirror.msu.net/pub/gentoo-portage/dev-ml/lablgtk/lablgtk-2.18.2.ebuild

Astronomy Picture of the Day . ... 10.01.2014 . ... Its last few thousand years have produced the Helix Nebula (NGC 7293), a well studied and nearby example of a Planetary Nebula , typical of this final phase of stellar evolution. ... The white dot at the Helix's center is this Planetary Nebula's hot, central star . ... NASA Web Site Statements, Warnings, and Disclaimers . ... Publications with keywords: Helix Nebula - planetary nebula . Publications with words: Helix Nebula - planetary nebula . ...

Еще в разделе: (Показать все результаты (>4600) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• Астронет > Infrared Helix
• Астронет > NGC 7293: The Helix Nebula

On the 3th of November a report of Drozdov Alexander, manager of Intel Corp. in Russia was presented on the seminar "Mathematics of computers, chips, and electronic circuits". ... Cadence Design Systems, Inc. and Intel, Corp. supports this seminar. ... The main purposes of this seminar are the following: . ... The seminar implements scientific and technical contacts for both domestic and foreign experts in the field of design and use of electronic computing systems. ... Seminar organization: . ...

Еще в разделе: (Показать все результаты (>32) - www.intsys.msu.ru/ )

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

... YUI 2 Examples . ... Contains an un-archived and ready for use copy of YUI 2.8.0 - see http://developer.yahoo.com/yui . ... You do not need to install anything in the browser to use this extension. ... Select "Install". ... See http://foswiki.org/Support/ManuallyInstallingExtensions for more help. ... Copyright : . ... update to v2.8.0 and add v3.0.0 -- Foswiki:Main.AndrewJones . ... http://foswiki.org/Extensions/YahooUserInterfaceContrib . This topic: System > YahooUserInterfaceContrib . ...

Еще в разделе: (Показать все результаты (>2106) - wiki.cs.msu.ru/ )

• JQueryLoader < System < Foswiki

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>50) - monkey.belozersky.msu.ru/ )

• SDP home page
• SCOP famyli:
• ETS numeration assumed

. [Назад к основному тексту]

Еще в разделе: (Показать все результаты (>198) - chem.msu.ru/ )

• Entrance Examinations - Preliminary Round
• Entrance Examinations - Main Round

local/bin/bash # GMT EXAMPLE 03 # # @(#)job03.bash 1.9 03/11/99 # # Purpose: Resample track data , do spectral analysis, and plot # GMT progs: filter1d , fitcircle , gmtset , minmax , project , sample1d , # spectrum1d , trend1d , pshistogram , psxy , pstext # Unix progs: $ AWK , cat, echo , head, paste, rm, tail # # This example begins with data files ... Thus the two data sets are not measured at the same of points, # and we use various GMT tools to facilitate their comparison. ...

Еще в разделе: (Показать все результаты (>25) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/example11.html
• http://xray.sai.msu.ru/~ivan/gmt/example02.html
• http://xray.sai.msu.ru/~ivan/gmt/example07.html

e-mail: dk89@mail.ru) , , , , John Foran, revolution, postmodern, globalization, political cultures of opposition "" . The article presents John Foran's experience of bulding a theory of postmodern revolution based on overcoming the discourses of "the end" of modern revolution theorie's components. ... It contains the experience of postmodern and modern revolution's components compare in the baise of concept of political culture of opposition. ...

Еще в разделе: (Показать все результаты (>11) - vestnik.socio.msu.ru/ )

vkgris@mail.ru The opportunity of detection and diagnostics of nano-object parameters in matter by relativistic electrons x-ray radiation generated in an investigated object is discussed. Polarization bremsstrahlung radiation (PB) of relativistic electrons on matter electrons is considered. ... C60 (60)2 (!) ... Grishin V.K. Polarization radiation from relativistic electrons in matter containing fullerenes// Nuclear instruments and Methods in Physics Research B, 2005, v.227, N 1-2, 82-86. ...

Еще в разделе: (Показать все результаты (>111) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/persons/VEKSLER/veksler100/reports/reports/Toneev_100VIV.11.10.07.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/240809/TristanDuPree.pdf

Prague, August 16, 2006 . ... We can decide to merge the GCVS with automatic surveys now. I have already outlined the difficulties and will give some examples illustrating the problems slightly later. Steve Kawaler's suggestion: 'The GCVS personnel might play a role as a `meta-catalog' - a central `index' of survey-based catalogs of variable stars'. ... If we want to have a good meta-catalog, the difficulties I have mentioned in relation to merging the catalogues still should be considered. ...

Еще в разделе: (Показать все результаты (>52) - sai.msu.ru/ )

... Seminars . ... Group 417 [ PDF ] Students are expected to attend lectures and seminars which is the standard forum for class communication. ... Some of the homework problems might appear on the tests and the exam. ... Your class grade total percentage is given by 40% seminar and homework, 25% first test and 35% second test. ... Students with the class grade 5 and 4 may get a final course grade without a final exam, but only upon the recommendation of seminar assistants. ... Test 1 [ PDF ] . ...

Еще в разделе: (Показать все результаты (>29) - nanofluidics.phys.msu.ru/ )