Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... 2015 Comparing the visual perception and aesthetic evaluation of natural landscapes in Russia and Japan: cultural and environmental factors . ... TAKAYAMA N. , PETROVA E. , MATSUSHIMA H. , UEDA H. , FURUYA K. , AOKI Y. в сборнике Japan Geoscience Union Meeting 2013 (May 19-24 2013 at Makuhari, Chiba, Japan). ...

Еще в разделе: (Показать все результаты (>2821) - istina.msu.ru/ )

• Compare - журнал | ИСТИНА - Интеллектуальная Система Тематического Исследования
• Garcia A.A. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Takayama N. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... Measurement of B-type natriuretic peptide by two assays utilizing antibodies with different epitope specificity. ... DESIGN AND METHODS: Plasma samples (n=94) from HF patients were analyzed by the novel-type "Single Epitope Sandwich" (SES assay prototype) and the conventional-type Siemens ADVIA Centaur BNP assays. ... RESULTS: The SES assay measured 1.2- to 7.2-fold (2.1+/-0.9; mean, SD) greater BNP concentrations compared to the Siemens assay. ...

Еще в разделе: (Показать все результаты (>168) - biochem.bio.msu.ru/ )

• Sperm-specific glyceraldehyde-3-phosphate dehydrogenase is stabilized by
• [Levels of fatty acid binding protein before and after direct current
• Spectral and kinetic parameters of phosphorescence of triplet chlorophyll a in

... Ivanovo State University . My experience as a Fulbright scholar in the USA gave me an ample opportunity to compare the structure, functions and modes of self-identification in the US and Russian academic communities. Overall, the American university system seemed more flexible and capable of self-adjusting to the demands of the moment. ... Though Russia is far behind the USA in technology and electronic media, we still can adopt some American educational technologies. ...

Еще в разделе: (Показать все результаты (>84) - www.prof.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>125) - www.genebee.msu.ru/ )

• AliComp - GeneBee Alignments Comparison - Advanced
• Fasta3 help
• GeneBee BLAST 2.2.8 Services

... Unlike the previous digital-only Messages, Arecibo-1974 and Evpatoria-1999, the TAM has complex, three-section structure with different forms of information. Section 1 represents coherent sounding radio signal with slow Doppler wavelength tuning to imitate transmission from Sun's center. ... Section 2 is an analog information and represents musical melodies, performed on the Theremin. ... There were seven musical compositions in the 1st Theremin Concert for Aliens. ...

Еще в разделе: (Показать все результаты (>431) - lnfm1.sai.msu.ru/ )

• My Links
• Trudy GAISH, vol. LXV, 1996, Abstracts in English
• Server LNFM1

... Программа на сентябрь 2008 г. 24 сентября. H. Wakaki (Hiroshima University). An error bound for Box's chi-square type asymptotic expansion of Wilks' Lambda distribution. Abstract. An error bound for the Box's chi-square type asymptotic expansion of Wilks' Lambda distribution is derived. It is compared with an error bound for the high-dimensional Edgeworth expansion. ... Convergence of Multinomial Goodness-of-fit Statistics to Chi-square Distribution. ...

Еще в разделе: (Показать все результаты (>44) - new.math.msu.su/ )

... The bright supernova (hereafter SN) in the galaxy NGC 4527 was first sighted by S. Knight (USA) on April 13.17UT at magnitude ~14.0v. The report of the sighting was subsequently forwarded by phone to the AAVSO. ... SN 1991T. The galaxy NGC 4527 is an Sb(s)II type galaxy with an apparent Blue magnitude of 11.32 (Shapley-Ames, 1981). ... An analysis of this event utilizing visual observations by amateurs, plus a light curve is presented.. ... THE LIGHT CURVE: . ... ISN SN 1991T web page . ...

Еще в разделе: (Показать все результаты (>55) - www.rochesterastronomy.org/ )

Russian abstract] . Russian full text] . The classifications revealed by geometric morphometry and classical morphometry for Drosera rotundifolia , D. obovata , D. anglica and D. linearis were compared. ... the form of petiole middle part transverse section is the effective distinguishing character for the some different species and inter-species hybrids of Drosera ; . the consensus configurations are preferable for the geometric morphometry analysis of populations. ...

Еще в разделе: (Показать все результаты (>266) - herba.msu.ru/ )

• The behavior of Nymphaea flowers

Correction of solar dopplergrams' large-scale flatfield" . Patrickeyev I.A., Mashnich G.P., Khlystova A.I., Zhang H. The authors have proposed and compared three different methods of large-scale flatfield correction (time averaging, Fourier filtering, and wavelet-based filtering). ... Patrickeyev I.A. - Institute of Continuum Mechanics, Russian Academy of Sciences, Korolyova 1, 614013, Perm, Russia; e-mail: pat@icmm.ru . ...

Еще в разделе: (Показать все результаты (>246) - num-meth.srcc.msu.ru/ )

• "A comparison of algorithms for spiral tomography"
• "Comparison of iterative methods for solving sparse linear systems in
• "A comparative analysis of protective arms of central Asian nomads with the

... We present some results of new calculations of D" ( t ) the second derivative of the Moon's elongation as a function of time. ... Let X be a set of all preserved recordings of observations of ancient Sun and Moon eclipses (see the list in [ 2 ], pp. 167 271): let A be a set of eclipses described in X (any eclipse a A may have some records corresponding to it and form X ( a )). ... The recount of dates t ( a 0 ), a 0 A ,( 700) < t ( a 0 ) < (+400), was first made by N. A. Morosov. ...

Еще в разделе: (Показать все результаты (>129) - hbar.phys.msu.ru/ )

... About lab . ... This project deals with objective comparison of video codecs, mostly of H.264 standard. In 2005-2006 two comparsons of video codecs were conducted by our lab. ... Mpegable AVC Codec . ... Used for comparison with H.264 codecs as well tuned codec from previous generation MPEG-4 ASP) . ... DivX 6.0 ( Not H.264 video codec, tested as reference codec) . ... First Annual MSU MPEG-4 AVC/H.264 Video Codecs Comparison . Second Annual MSU MPEG-4 AVC/H.264 Video Codecs Comparison . ...

Еще в разделе: (Показать все результаты (>261) - graphics.cs.msu.ru/ )

• Objective comparison of H.264 video codecs | Лаборатория компьютерной графики и
• MSU Video Codec Comparison | Graphics and Media Lab
• MSU Video Codec Comparison | Лаборатория компьютерной графики и мультимедиа

Данный сайт является частью более общей системы IT-поддержки факультета ВМК . ... Этот сайт дает возможность пользователям факультета ВМК узнать о том, какие технические услуги им доступны, как их запросить и как ими воспользоваться. ... Подробное описание где мы и кто мы . ... Подробное описание всех наших IT-услуг на факультете ВМК . ... Описание устройства сетей факультета . ... V iew topic | ... Copyright by the contributing authors. ... Ideas, requests, problems regarding Foswiki? ...

Еще в разделе: (Показать все результаты (>3703) - wiki.cmc.msu.ru/ )

• (compare) RootCAThunderbird < Main < Foswiki
• (compare) UKRF274 < Main < Foswiki
• (compare) FrAnQu < Main < Foswiki

... ID белка . ... TRUB_ECOLI . ... TRUB_SHIFL . ... В первом файле содержатся последовательность белка TRUB_ECOLI и его ближайшего гомолога, во втором ? ... Последовательности генов белка TRUB_ECOLI и его гомолога TRUB_SHIFL различаются в 32 положениях, и лишь одно различие привело к аминокислотной замене. ... Разницу в нуклеотидных остатках гена TRUB_ECOLI и его гомолога TRUB_SHIFL, а так же "матрицу замен" нуклеотидов: какие замены наблюдаются и в каком количестве можно посмотреть здесь . ...

Еще в разделе: (Показать все результаты (>939) - kodomo.cmm.msu.ru/ )

• Term4

THz pulses generation in gases under optical breakdown condition. Diploma thesis abstract During the last years, the laser breakdown plasma is shown as a new good practical media for generat ion of THz pulses and their further conversio n into the other spectral regio ns. The values of the achieving in the plasma experiments THz field is co mparable then with the use of the other sources and medium such as photoconductive antenna, nonlinear crystals etc. ...

Еще в разделе: (Показать все результаты (>263) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2007/Dubinin_Cherezova_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2007/Khakhulin_Volkov_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2006/Grigorievskiy_Kosareva_en.pdf

University Satellites and . Space Science Education . ... News . ... Internet seminars as the new way of Inter-University Aerospace Centre activity . ... In such a dynamic field as remote sensing, the Internet resources already beat traditional libraries and image depositories. ... In 2000-2005 seven Internet-based seminars were held: "Obtaining satellite images over Internet". ... Images of new types. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>6700) - cosmos.msu.ru/ )

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>210) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/134.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/106.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/50.pdf

... Gussakovsky Eugene Fluorescence, Diffuse Reflectance and NIR Imaging in Cardiovascular Research and Diagnostics (Gussakovsky E., Kupriyanov V., Sowa M.) . ... Brazhe Aleksej Rudol'fovich Cell dynamics exposed in the light of interference microscopy (Brazhe A.R., Brazhe N.A., Maksimov G.V.) . Brazhe Nadezhda Aleksandrovna Mechanisms of nitric oxide influence on the membrane structures of the cell (Brazhe N.A., Maksimov G.V.) . ... Maksimov G.V.) . ...

Еще в разделе: (Показать все результаты (>82) - www.msm.biophys.msu.ru/ )

• MSM 2007

Backlinks to HistoryPlugin in System Web ( Search all webs ) . CompareRevisionsAddOn . ... NEW - 02 May 2014 - 02:14 by ProjectContributor . ... CompareRevisionsAddOn Plugin This is an helper plugin for the CompareRevisionsAddOn on Foswiki It has two purposes: 1 It sets the CompareRevisionAddonPluginEnabled .. ... VarHISTORY HISTORY{ attributes } control attributes of tables and sorting of table columns * The %HISTORY{}% macro is handled by the HistoryPlugin * Syntax .. ...

Еще в разделе: (Показать все результаты (>1423) - wiki.cs.msu.ru/ )

• (backlinks in System Web) ContributedAddOns < System < Foswiki
• (backlinks in all Webs) HistoryPlugin < System < Foswiki
• (backlinks in all Webs) SitePreferences < Main < Foswiki

... calg:dubna07:abstracts ]] . THEP . ... 03/ 062007 18:10 kryukov 03/ 062007 18:09 kryukov 03/ 062007 18:09 kryukov 03/ 062007 18:08 kryukov 03/ 062007 18:08 kryukov 03/ 062007 18:07 kryukov 03/ 062007 18:06 kryukov 03/ 062007 18:06 kryukov 03/ 062007 18:05 kryukov 03/ 062007 17:54 kryukov 03/ 062007 17:49 kryukov 03/ 062007 17:49 kryukov 03/ 062007 17:45 kryukov 03/ ... calg/dubna07/abstracts.1180879610.txt.gz ۤ Last modified: 03/062007 18:06 by kryukov . ...

Еще в разделе: (Показать все результаты (>2056) - theory.sinp.msu.ru/ )

• [FedStor] Fwd: [sc-papers] CFP: SC16 tech papers: abstracts due March 27
• calg:dubna07:abstracts - Old revisions [THEP]
• [RU-NGI] Fwd: ACAT2014 workshop Bulletin 2, abstract submission and

... ИСТОРИЯ ГАИШ - хроника, музей, персоналии, мемуары, периодика . Сайт "HERITAGE - астрономия, астрономическое образование с сохранением традиций" ориентирован на студентов 1 и 2-го курсов астрономического отделения физического факультета МГУ и отражает ранением традиций" ориентирован на студентов 1 и 2-го курсов астрономического отделения физического факультета МГУ и отражает работу, проводимую сотрудниками ГАИШ МГУ и физического факультета МГУ по расширению астрономического образования студентов. ...

Еще в разделе: (Показать все результаты (>10) - heritage.sai.msu.ru/ )