... id #1228 . ... Common information . ... no information] . ... since 1900-01-01 till today . ... The Journal of the Southern Appalachian Botanical Society . ... Southern Appalachian Botanical Society . ... today . ...

Еще в разделе: (Показать все результаты (>21) - journals.genebee.msu.ru/ )

... The Mango is the National fruit of India where it is known as `The King of Fruits'. ... Optimal Climate and Growing Conditions Mango's require a frost-free climate where temperatures dropping below 40 °F will kill flowers and small fruits. ... The fruit of a tree matures in 100-150 days after flowering and will have the best flavor if allowed to ripen on the tree Harvesting The Mango Mango's Nutritional Facts They are a good source of vitamin A and C, as well as dietary fibers. ...

Еще в разделе: (Показать все результаты (>147) - herba.msu.ru/ )

• http://herba.msu.ru/shipunov/school/biol_330/2013_2014/presentations/sweet_potato/sweet_potato_presentation.pdf
• A study of freshwater invertebrates of the environs of Podpakhta Inlet and

... Ключевые слова: Наука в университетах. ... Национальная система оценки университетов в Японии по данным отчета Института общественных наук (Токийский университет), 1999 г. Ключевые слова: Рейтинги университетов. ... Leuenberger T. The "Learning from European knowledge partnership" roundtable, University of Tokyo, February 14, 2002 // Social science Japan . ... Круглый стол в Токийском университете" 14 февраля 2002 г. Ключевые слова: Роль университетов в жизни общества. ... ЗАРУБЕЖНЫЕ УНИВЕРСИТЕТЫ. ...

Еще в разделе: (Показать все результаты (>25) - srcc.msu.ru/ )

• http://srcc.msu.ru/nivc/about/lab/lab1_7/univer_press4/ItemsN3.htm
• http://srcc.msu.ru/nivc/about/lab/lab1_7/univer_press4/Journals1.htm
• Cluster analysis for pattern recognition in solar butterfly diagrams, AN, {\bf

Дастся обзор поиска ВЦ в южной полусфере за прошедшие 30 лет. ... Две такие системы одновременно работают в радиообсерваториях Oak Ridge Гарвардского университета и в IAR Описаны также первые оптические SET1 наблюдения в южной полусфере с помощью аппаратуры МАНИЯ , установленной на 2.15 м. телескопе CASLEO в провинции Сан Хуан, Аргентина Система МАНИЯ , разработанная в Специальной Астрофизическом Обсерватории РАН под руководством В. Ф Шварцмана, позволяет регистрировать временные ...

Еще в разделе: (Показать все результаты (>62) - lnfm1.sai.msu.ru/ )

• Trip over old Shanghai
• jg0012
• jg0014

" " ­ .. , . . , . () , " ", " ", " ", " ", " " sociology of religion, the country of the "global South", the country of the"Third World", "next Christendom", "new Christianity", «Southern Christianity» " " (" ", " "), " ", " " . The author analyzes the phenomenon of the "next Christendom" ("New Christianity", "Southern Christianity") distributed in "Third World", in the socalled "global South" and characterizes religion in the modern era.

Еще в разделе: (Показать все результаты (>11) - vestnik.socio.msu.ru/ )

... The article describes the role of propaganda campaign of the South against the North during the Civil War of the USA (1861 1865). The author analyses the goals, methods and channels of propaganda of the Confederation and explores the interconnection of propaganda operations with the events of the war. The author concludes that in the context of war, propaganda is formed by philosophy of the society, while the outcome of a war depends mainly on well-timed rational choice of propaganda methods. ...

Еще в разделе: (Показать все результаты (>16) - ee-journal.spa.msu.ru/ )

... unknown) Pattern Modifiers -- Describes possible modifiers in regex patterns . ... If this modifier is set, letters in the pattern match both upper and lower case letters. m (PCRE_MULTILINE) . By default, PCRE treats the subject string as consisting of a single "line" of characters (even if it actually contains several newlines). ... If there are no "\n" characters in a subject string, or no occurrences of ^ or $ in a pattern, setting this modifier has no effect. s (PCRE_DOTALL) . ...

Еще в разделе: (Показать все результаты (>58) - oit.cmc.msu.ru/ )

• pdf_begin_pattern
• pdf_end_pattern
• preg_replace

... Plain examples: path:foo/bar a name bar in a directory named foo in the root of the repository path:path:name a file or directory named "path:name" Glob examples: glob:*.c any name ending in ".c" in the current directory *.c any name ending in ".c" in the current directory **.c any name ending in ".c" in any subdirectory of the current directory including itself. foo/*.c any name ending in ".c" in the directory foo foo/**.c any name ending in ".c" in any subdirectory of foo including itself. ...

Еще в разделе: (Показать все результаты (>3283) - kodomo.fbb.msu.ru/ )

• Help 10 (patterns)
• Task 10 (patterns), 2010
• Task9 (patterns), 2009

... Plain examples: path:foo/bar a name bar in a directory named foo in the root of the repository path:path:name a file or directory named "path:name" Glob examples: glob:*.c any name ending in ".c" in the current directory *.c any name ending in ".c" in the current directory **.c any name ending in ".c" in any subdirectory of the current directory including itself. foo/*.c any name ending in ".c" in the directory foo foo/**.c any name ending in ".c" in any subdirectory of foo including itself. ...

Еще в разделе: (Показать все результаты (>848) - kodomo.cmm.msu.ru/ )

• Patterns Prosites
• Help 10(patterns)/term2/2007
• Pattern 2

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... Video tracking and behavior segmentation of laboratory rodents. Pattern Recognition and Image Analysis . ...

Еще в разделе: (Показать все результаты (>93) - graphics.cs.msu.ru/ )

• High-Quality Algorithm for Bayer Pattern Interpolation | Graphics and Media Lab
• High-Quality Algorithm for Bayer Pattern Interpolation | Лаборатория

... Screening pattern or alignment against protein databank . ... Protein databanks . SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Pattern Alignment . ... Pattern (or alignment) . Pattern example 1: . ... Alignment example: . FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...

Еще в разделе: (Показать все результаты (>67) - www.genebee.msu.ru/ )

• Screening of pattern or alignment against PROTEIN databank

Neutrino telescope in Northern Hemisphere . ... about ANTARES . ... ANTARES is the name of a neutrino telescope residing in the Mediterranean Sea off the coast of Toulon, France. ... Other neutrino telescopes designed for use in the nearby area include the Greek NESTOR telescope and the Italian NEMO telescope, which are both in early design stages. ... In contrast to the South Pole neutrino telescopes AMANDA and IceCube, ANTARES uses water instead of ice as its Cherenkov medium. ...

Еще в разделе: (Показать все результаты (>3) - antares.sinp.msu.ru/ )

... Pattern 3: Extract the parent of a given topic . ... form> <select> %SEARCH{ "^\|[^\|]*\| *option *\|" topic="%TOPIC%" type="regex" multiple="on" nonoise="on" format="<option>$pattern(^\| *(.*?) *\|.*)</option>" }% </select> </form> . ... Use this search: <select> %SEARCH{ "^\|[^\*\|]*\|" topic="CountryList" type="regex" multiple="on" nonoise="on" format="<option>$pattern(^\| *(.*?) *\|.*)</option>" }% </select> . ... This topic: System > WebHome > Macros > FormattedSearch > SearchPatternCookbook . ...

Еще в разделе: (Показать все результаты (>2775) - wiki.cmc.msu.ru/ )

• VarINCLUDE < System < Foswiki

Б.П. Леонтьев . ... The very first problem is to select American Educational Materials (AEM), which are of high quality and wide nomenclature. ... Analysis undertaken in [ 1,3 ] revealed time patterns in this process. Time milestones are given to work out original educational and research products, which are based on redesign of AEM and on intercultural experience acquired during participation in JFDP. ...

Еще в разделе: (Показать все результаты (>30) - www.prof.msu.ru/ )

Mathematical simulation of creep processes in metal patterns made of materials with different extension compression properties" . Korobeynikov S.N., Oleinikov A.I., Gorev B.V., Bormotin K.S. An algorithm for numerical solving the problems of creep in metal patterns made of materials with different extension and compression properties has been developed. ... The problems of twisting during the creep of metal plates under constant concentrated forces applied at the corner points have been solved. ...

Еще в разделе: (Показать все результаты (>26) - num-meth.srcc.msu.ru/ )

• A parallel implementation of sediment transport and bottom surface
• "A small-mode approximation in the stellar dynamo problem"
• "Complexity of geometric optimization by rasterization of Minkowski sums"

... We consider now change-points in different components of the frequency spectrum of typical EEG signal. ... Only few change-points in power are found in the initial EEG (unless a prominent alpha rhythm is present). ... Change-points in different frequency components of the EEG . ... Change-points in different types of the EEG alpha activity without substantial gradual changes . ... As can be seen from Fig. 7.3, the program reliably detected the change-points despite of such variety of signal patterns...

Еще в разделе: (Показать все результаты (>45) - brain.bio.msu.ru/ )

The QRegExp class provides pattern matching using regular expressions and wildcards. ... QRegExp  ( const char *, bool caseSensitive=TRUE, bool wildcard=FALSE )  . ... QRegExp&  operator=  ( const char * pattern )  . bool  operator==  ( const QRegExp & ) const . ... bool  wildcard  () const . ... QRegExp knows these regexp primitives: . ... Returns TRUE if this regexp is equal to r. Two regexp objects are equal if they have equal pattern strings, case sensitivity options and wildcard options. ...

Еще в разделе: (Показать все результаты (>70) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QBrush Class

... Emerging renewable energy conversion and storage" | ... Katharina Al-Shamery (University of Oldenburg, Germany) | ... Horst-GЭnter Rubahn (University of Southern Denmark, Soenderborg, | Denmark) | ... Monday, September 9, 2013 | ... Session I: | Solar energy conversion | 14.30-16.00 |Photovoltaic energy conversion - | ... Coffee break | ... University of TЭbingen, Germany) | ... Tuesday, September 10, 2013 | ... Coffee break and poster session | ... Renewable Energy Conversion and | ...

Еще в разделе: (Показать все результаты (>43) - polly.phys.msu.ru/ )

• http://poly.phys.msu.ru/en/news/attach/2007_12_17.pdf
• http://poly.phys.msu.ru/ru/seminar/vms/25092001/seminar250901.pdf

... Список форумов | ... Новый пользователь | ... Пользователи . Пользователь . ...

Еще в разделе: (Показать все результаты (>453) - www.fds-net.ru/ )

• DIY - Public forum of MSU united student networks
• Agile Software Development. Principles, Patterns and Practices - Public forum

... Rector of Bauman Moscow State Technical University, the President of the Association of Technical Universities . ... Rector of Southern Federal University, the Chairman of the Council of Rectors of the South of Russia . ... The President of Bauman Moscow State Technical University, the Chairman of the Council of Rectors of the Central Federal District . ... Rector of Moscow Institute of Physics and Technology (State University), the Chairman of the Council of Rectors of Moscow and Moscow Oblast . ...

Еще в разделе: (Показать все результаты (>7) - www.rsr-online.ru/ )

• BOROVSKAYA MARINA ALEXANDROVNA