Network Working Group Request for Comments: 1733 Category: Informational M. Crispin University of Washington December 1994 DISTRIBUTED ELECTRONIC MAIL MODELS IN IMAP4 Status of this Memo This memo provides information for the Internet community. ... Distributed Electronic Mail Models There are three fundamental models of client/server email: offline, online, and disconnected use. ... In this model, a client application manipulates mailbox data on a server machine. ...

Еще в разделе: (Показать все результаты (>21455) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1733.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc7818.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc7818.txt.pdf

Fortran-DVM . ... Language description . ... 2.2 Syntax of FDVM directives . ... 4.2 Distribution of dynamic arrays . ... 6 Remote data specification . ... 6.2 SHADOW type references . ... 6.2.2 Synchronous specification of independent references of SHADOW type for single loop . ... 6.2.5 Asynchronous specification of independent references of SHADOW type . ... 6.3.3 Asynchronous specification of REMOTE type references . ... 6.4.2 Asynchronous specification of REDUCTION type references . ...

Еще в разделе: (Показать все результаты (>142) - sp.cs.msu.ru/ )

• C-DVM language description
• Специальный курс Управляемая моделями разработка программного обеспечения
• Fortran DVM - Language for Portable Parallel Programs Development

... Faculties . ... General Information . ... Study and Research . ... The Faculty has 18 departments: Department of General Mathematics , Department of Non-Linear Dynamic Systems and Control Processes, Department of Mathematical Physics, Department of Computational Methods, Department of Research Automation, Department of Operations Research , Department of Optimal Control, Department of System Analysis, Department of Mathematical Statistics, ...

Еще в разделе: (Показать все результаты (>126) - www.msu.ru/ )

• Faculty of Mechanics and Mathematics
• FACULTY OF MECHANICS AND MATHEMATICS
• Faculty of Geology

. R. I. Podlovchenko 'Finitc Models and Algebraic Model of Programs'// International Workshop 'Automata, algorithms and information technologies' (Kyev, May 19-21, 2010), Abstracts, Kiev, 2010, p. 19. Ключевые слова:

Еще в разделе: (Показать все результаты (>241) - srcc.msu.ru/ )

• Glazunov A.V., Dymnikov V.P., Lykossov V.N. Mathematical modelling of spatial
• Mikushin, D.N., and V.M. Stepanenko. The implementation of regional atmospheric
• D. Chechin, C. Luepkes, I. Repina. Mesoscale modelling of an off-ice flow in

.

Еще в разделе: (Показать все результаты (>552) - comet.sai.msu.ru/ )

• HTML Math
• Paragraphs
• Block Quotes

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>31) - mouse.belozersky.msu.ru/ )

... Kalyuzhnyi S. and Fedorovich V. (1997) Integrated mathematical model of UASB reactor for competition between sulfate reduction and methanogenesis. ... Kalyuzhnyi S.V. and Fedorovich V.V. (1998) Mathematical modeling of competition between sulphate reduction and methanogenesis in anaerobic reactors. ... Kalyuzhnyi S., Fedorovich V., Lens P., Hulshoff Pol L., Lettinga G. (1998) Mathematical modeling as a tool to study population dynamics between sulfate reducing and methanogenic bacteria. ...

Еще в разделе: (Показать все результаты (>147) - www.enzyme.chem.msu.ru/ )

Faculty of Physics, Lomonosov Moscow State University Advanced Quantum Field Theory: Modern Applications in HEP, Astro & Cond-Mat Instructor: assist. prof., Dr. Oleg Kharlanov Term 2 Examination Syllabus (Fall 2014) 1. ... Self-consistent field approximation: the Hartree­Fock and Hartree­Fock­Roothaan equations; a qualitative analysis of the approximations used. ... Fundamentals of the Density functional theory: the energy functional, the Hohenberg­Kohn theorems, the universal functional F[n(x)] . ...

Еще в разделе: (Показать все результаты (>13) - theorphys.phys.msu.ru/ )

... To acquaint the reader with nonlinear dynamic systems; . ... The geology investigates of the Earth as a dynamic system. ... The analysis of behavior of systems with nonlinear interplay during time is a subject of this E-textbook. ... Key words: geological processes, dynamic system, nonlinear processes, chaotic dynamics, deterministic chaos, fractals. ... Chapter 1. ... For more information concerning the E-textbook "Dynamic processes in geology: Introduction to nonlinear systems" refer to the...

Еще в разделе: (Показать все результаты (>29) - dynamo.geol.msu.ru/ )

• V.Zakharov's Ph.D. thesis
• Publications of V.Zakharov

О лаборатории . ... Лаборатория теоретической биофизики . ... For lipid bilayer modelling the whole toolchain was built: from creating membranes to MD trajectory analysis. ... We use OPLS-AA with some includings; ?includings? are overlays on the standart GROMACS forcefield files. ... 4 комментариев " Lipid membrane MD modeling with GROMACS " . Python membrane generator for MD simulations ERG Research Group: Лаборатория теоретической биофизики написал (Февраль 14th, 2012 4:11 пп) . ...

Еще в разделе: (Показать все результаты (>33) - erg.biophys.msu.ru/ )

• membrane ERG Research Group: Лаборатория теоретической биофизики
• comcon1 ERG Research Group: Лаборатория теоретической биофизики
• gromacs ERG Research Group: Лаборатория теоретической биофизики

. Name . Last modified . Size . Description . Parent Directory . - . 01_comp_model/ . 26-Sep-2011 12:35 . - . 02_life/ . 26-Sep-2011 12:35 . - . index.html . 26-Sep-2011 12:35 . 7.4K . model.gif . 26-Sep-2011 12:35 . 141K . Apache/2.2.16 (Debian) Server at uneex.lorien.cs.msu.su Port 80

Еще в разделе: (Показать все результаты (>860) - uneex.lorien.cs.msu.su/ )

• Открытая модель ПО в образовании -- The open model of software in education
• Index of /static/AltDocs_informatika2/Book2/ch_09_model/01_model/02_life
• Открытая модель ПО в образовании - The open model of software in education

. Name . Last modified . Size . Description . Parent Directory . - . 01_comp_model/ . 26-Sep-2011 12:35 . - . 02_life/ . 26-Sep-2011 12:35 . - . index.html . 26-Sep-2011 12:35 . 7.4K . model.gif . 26-Sep-2011 12:35 . 141K . Apache/2.2.16 (Debian) Server at uneex.mithril.cs.msu.su Port 80

Еще в разделе: (Показать все результаты (>212) - uneex.mithril.cs.msu.su/ )

• Index of /static/AltDocs_informatika2/Book2/ch_09_model/01_model/02_life
• Index of /static/AltDocs_informatika2/Book2/ch_09_model
• Index of /static/AltDocs_informatika2/Book2/ch_09_model/02_programming

Large-scale QC modeling using PC GAMESS package. ... PC GAMESS vs. ... Modeling of large systems linear scaling methods for HF, DFT , CIS, TDHF, and TDDFT Linear scaling methods , current status Fast linear scaling Coulomb (J matrix) assembly via QFMM and near-field J engine State-of-the-art grid-based ExchangeCorrelation integration for linear scaling DFT and TDDFT State-of-the-art linear scaling HF exchange (K matrix) assembly for HF, hybrid ...

Еще в разделе: (Показать все результаты (>91) - classic.chem.msu.su/ )

• The PC GAMESS SMP scaling results for model MP4-SDQ job

RNA Tertiary Structure Modelling . ... Two steps to fold coarse-grained model of RNA tertiary structure . ... fill in RNA secondary structure form with CT format (also with pseudoknots); . ... push "Finish Step #1" button to obtain secondary and intermediate* structures. * intermediate structure is the structure with minimum of "free energy" contains formed helixes and stacking, but without tertiary interactions . RNA secondary structure form . ... some useful RNA secondary structure databases: . ...

Еще в разделе: (Показать все результаты (>41256) - dualopt1.cmm.msu.ru/ )

• TmrnaEnglish - Projects - TWiki
• WebPreferences - Services - TWiki - (printable)
• %TOPICTITLE% (1 vs. 2) - TWiki

KEYWORDS: language evolution, mathematical modelling, branching processes . ... 2 Basic assumptions. ... Dying out, giving birth, and preserving of sign's meanings. ... Modelling of language evolution should be based on some assumptions concerning its micro-level, i.e. level of its micro-units' development. ... That is why it has become the starting point in the building of the mathematical model for the development in time and synchronic correlation of the whole system of a sign's features. ...

Еще в разделе: (Показать все результаты (>86) - old.philol.msu.ru/ )

• МГУ-ЛОКЛЛ:: Библиография основных работ А.А. Поликарпова за последние годы

Model page И.Л. Алексеева "Категории национального в исламском дискурсе нового времени: "миллет" и умма"" . Model page М.В. Дмитриева 'Влияние православных традиций на формирование протонациональных и национальных дискурсов в русской культуре XIX-XX вв.' Программы курсов М.В. Дмитриева по этническим и национальным традициям в христианских культурах. Model page М.В. Дмитриева: 'Этнос, конфессия, национализм в истории Восточной Европы". ...

Еще в разделе: (Показать все результаты (>160) - hist.msu.ru/ )

• Model pages и материалы проекта
• Виртуальные реконструкции городов Древнего мира
• An Estimation of the National Economy's Losses Caused by the Priority in

Astronomy Picture of the Day . ... The Sudbury Neutrino Observatory Institute Explanation: The Sudbury Neutrino Observatory (SNO) has been detecting so few neutrinos from the Sun that the Standard Model of fundamental particles in the universe may have to be revised. Pictured above is the SNO as it was being built. ... The most popular model for fundamental particles , known as the Standard Model , did not predict such schizophrenic neutrinos . ... The Sudbury Neutrino Detector . ...

Еще в разделе: (Показать все результаты (>7093) - www.astronet.ru/ )

• Астронет > Sudbury Indicates Nonstandard Particle Model
• Dark Matter Ring Modeled around Galaxy Cluster CL0024 17
• Астронет > Dark Matter Ring Modeled around Galaxy Cluster CL0024 17

... О физическом факультете . ... Помощь факультету . ССО факультета . ... Система электронного документооборота (СЭД) МГУ . ... Физический факультет . ... Наш факультет . Новости факультета . История факультета . Подразделения факультета . Выпускники факультета . ... Журнал "Ученые записки физич. факультета МГУ" . ... Научные семинары . ... Журнал "Ученые записки физического факультета МГУ" . ... Тема: 'Modeling and Control of Physiological Process: Towards Systems Medicine'. ...

Еще в разделе: (Показать все результаты (>292) - phys.msu.ru/ )

• Title

... 30-Nov-2012 14:26 . ... 25-Sep-2012 19:15 . ... 9.2K . ... 334 . ... 04-Oct-2013 21:59 . ... 28-May-2015 19:48 . ... 25-Jun-2013 07:34 . ... sep_probability_model.php . ...

Еще в разделе: (Показать все результаты (>1333) - swx.sinp.msu.ru/ )

• Index of /models/temp
• Index of /models/database/db/001124
• Index of /models/database/db/010128

... Modeling of the glutamate NMDA receptor, design and virtual screening of its ligands as potential neuroprotector agents to treat Alzheimer's disease, Parkinson disease and schizophrenia . ... Modulators of NMDA receptor are studied as potential neuroprotector agents to treat Alzheimer's disease, Parkinson disease and schizophrenia. ... Biochem. ... Biochem Biophys. ... NMDA receptor modeling . ... 2016 Laboratory of Medicinal Chemistry ...

Еще в разделе: (Показать все результаты (>24) - qsar.chem.msu.ru/ )

• Research - Laboratory of Medicinal Chemistry
• Home - Laboratory of Medicinal Chemistry