Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Издательство: Current Science Inc. ...

Еще в разделе: (Показать все результаты (>921) - istina.msu.ru/ )

• Option/Bio - журнал | ИСТИНА - Интеллектуальная Система Тематического
• Current Treatment Options in Cardiovascular Medicine - журнал | ИСТИНА -
• Current Treatment Options in Oncology - журнал | ИСТИНА - Интеллектуальная

... To create a Hysteresys calibration file user should do the following: . Nodal points with known distances between them should be marked using poly line (Curve) on the obtained image of a calibration sample. ... Figure 2.12: Table that allow to define points that are needed for calibration plots generation. ... In this case user should obtain two separate calibration files for fast and slow scanning direction(x-calibration Х y-calibration-slow). ... Then we should unite these two files in one. ...

Еще в разделе: (Показать все результаты (>77) - www.spm.genebee.msu.ru/ )

• FemtoScan Online FAQs
• Index
• Предметный указатель

... This applet generates an observing list based on an observer's location and time. ... To use this program, enter in your location, and the local times at which you wish to begin and end observing. The date you enter should correspond to the calendar day at the time at which you begin observing. For example, if you wish to observe from 9:37 PM October 23, 2007 until 3:21 AM October 24, 2007, you would enter 21:37 for the starting time, 03:21 for the finish time, and 10/23/2007 for the date. ...

Еще в разделе: (Показать все результаты (>18) - observ.pereplet.ru/ )

• MASTER GLOBAL ROBOTIC TELESCOPES NET

Debugging DVM-programs . User's guide . ... 10.2 Obtaining debug versions of DVM-program for sequential and parallel execution . ... 10.4 Accumulation of DVM-program reference trace file . ... examining the execution trace when the program is executed in parallel mode (see section 5); . ... The command to start debug parallel version of DVM-program comparing execution results of executing the program on one processor, with previously accumulated reference trace. dvm red <DVM-program_name> . ...

Еще в разделе: (Показать все результаты (>124) - sp.cs.msu.ru/ )

• Prefictor of DVM-program performance. User's guide
• C-DVM compiler. User's guide
• DVM-system. Installation guide. Version 3.95

The use of the external module Ab_An.dll Ab_An.dll file is an external module for the Gibbs program, and is designed to calculate the activity coefficients of the components of albite- anortite solid solution. ... A non-ideal model of albite-anortite solid solution, proposed in literature [1], is used in this module. ... Preparation of the System file To be able to use the module Ab_An.dll, you need to include a binary solid solution of albite and anortite into the System file, as you create it. ...

Еще в разделе: (Показать все результаты (>58) - www.geol.msu.ru/ )

• http://www.geol.msu.ru/deps/geochems/soft/en/Electrum.doc
• http://www.geol.msu.ru/deps/geochems/soft/en/GibbsExt.doc
• http://www.geol.msu.ru/deps/geochems/soft/en/ZnS_FeS.doc

Prague, August 16, 2006 . Our trial revision of the GCVS data for several southern constellations show that type changes are not needed for most stars. ... We suggest to add one more symbol combining types, in the cases when two or more classification options remain for the same star, for example, EC|Ell, EC|RR (here EC means a contact eclipsing binary, this is one of our suggestions from next slides). ... Moreover, it will simplify moving stars from the suspected-variable catalogue to the GCVS. ...

Еще в разделе: (Показать все результаты (>75) - sai.msu.ru/ )

• International School "Frontiers in Numerical Gravitational Astrophysics"

... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>73) - imaging.cmc.msu.ru/ )

... We consider now change-points in different components of the frequency spectrum of typical EEG signal. ... Only few change-points in power are found in the initial EEG (unless a prominent alpha rhythm is present). ... Change-points in different frequency components of the EEG . ... Change-points in different types of the EEG alpha activity without substantial gradual changes . ... As can be seen from Fig. 7.3, the program reliably detected the change-points despite of such variety of signal patterns...

Еще в разделе: (Показать все результаты (>43) - brain.bio.msu.ru/ )

• Change-points at different levels of the hierarchy of EEG segmental...
• Other prospects of the change-point based analysis
• Analysis of change-point synchronization in multi-channel EEG

... J. 15(2): 263-268 ї RUSSIAN ENTOMOLOGICAL JOURNAL, 2006 3I, a new program for creating Internet-accessible interactive keys and taxonomic databases and its application for taxonomy of Cicadina (Homoptera) 3I - новая программа для создания интерактивных определительных таблиц и таксономических баз данных для Интернета и ее применение в систематике цикадовых (Homoptera: Cicadina) Dmitry A. Dmitriev Д.А. Дмитриев Illinois Natural History Survey, 1816 South Oak Street, Champaign IL 61820, USA. ...

Еще в разделе: (Показать все результаты (>1227) - zmmu.msu.ru/ )

• Uropatagium venation pattern in bats as diagnostic character (by the example of
• Russian Journal of Theriology

... About hotel . ... The hotel ?69th Parallel? is glad to present its renewed website which now has an option of online booking! ... Great stay! dns_support@antihotmail.com . ... Great hotel! ... best place in Murmansk that I've stayed! Add me to your mailing list for special offers . ... Stay was great. ... Always nice to have a good nights rest while enroute to my destinations. ... Very nice place . ... What a beautiful place, we enjoyed our stay! ... Best place ever! ... Your hotel was so nice. ...

Еще в разделе: (Показать все результаты (>22) - 69parallel.ru/ )

• Hotel "69 Parallel" - Restaraunts
• Hotel "69 Parallel" - Rooms and prices
• Hotel "69 Parallel" - Main

... You have to choose only one answer among the suggested options; for tasks 1-4 write down `agree' beside the answer you choose. ... Peptide bond between amino acids in a molecule of protein is underlaid by: a) b) c) d) the principle of complementarity; insolubility of amino ac ids in water; solubility of amino acids in water; the presence of carboxy and amino group; Task 2. ... There are ten cards, each with one side white and one side black. ... What is your understanding of the word "progress"? ...

Еще в разделе: (Показать все результаты (>136) - www.psy.msu.ru/ )

• http://www.psy.msu.ru/science/psyrussia/2009/podolskij.pdf

... Field size . Object name . ... Map size . ... Field size: the approximate size of the map in the Y direction. ... Galaxies: . ... Galaxies, which size exceeds some value depending on the field and map sizes, are displayed with their real positional angles and sizes by 25m isophote. ... In the "tools" fields there are links to the several famous AVO (Astrophysical Virtual Observatory) resources: NED and Simbad databases and DSS2 (Palomar Digitized Sky Survey) images of the corresponding sky area. ...

Еще в разделе: (Показать все результаты (>5377) - www.astronet.ru/ )

• Saguaro Moon
• September s Harvest Moon
• Journal "Peremennye Zvezdy"

CALCSYM - complex evaluator . ... CALCSYM.exe and CALCSYMi.exe will allow you to obtain numeric solution for *.out file generated by both CIRSYM and MATSYM programs (computation of freqency responces, unknowns, determinants, sensitivity analysis etc.. ... Setup file name for CALCSYM is "setup.cal". ... CALCSYMi.exe will allow you to work with long double over the range from 3.4*E-4932 to 3.4*E+4932. ... To calculate, run CALCSYM.exe and enter "file_name.OUT" or click on the "ENTER" (in "OUT" case). ...

Еще в разделе: (Показать все результаты (>9) - astrometric.sai.msu.ru/ )

• Symbolic circuit processor

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

56. Чтобы сделать nature.web.ru своей стартовой страницей:

57. http://www.paleopedology.msu.ru/discussions/messages/246.html

58. Hotel "69 Parallel" - Guestbook

59. [JavaScript в Opera] помогите разобраться - Public forum of MSU united student

60. [JavaScript в Opera] помогите разобраться - Public forum of MSU united student