1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

... Koyukon Athabaskan Dictionary.[henceforth: KAD] Fairbanks: ANLC, 2001. 1118 pp. ... English verbs with a verbal equivalent in Koyukon : 125 ­ 18 = 107 o English verbs , out of 107, with some derivational affixes (sit down): 6 (6%) · Derivational morphemes per 107 English verbs : 8 o Average number of lexical morphemes per an English verb ­ 1.07 · Adjustment of the number of Koyukon items in the database, due to: o Two or three equivalents to one English ...

Еще в разделе: (Показать все результаты (>370) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/kuznetsova.pdf
• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/slioussar.pdf
• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/files/Case-Head%202006%20%23%23%23A.pdf

... Now let us consider that damping or amplitude of the signal like a natural index of a hypothetical inequality or mean between the action and reaction, or the kinetic and the potential energy of the system. The time between the action and the reaction must be different from zero. ... We can describe this behaviour in its simpler form by the oscillation of a balance with inertiality or sensitivity, that is to say, with a time of reaction for the operations of adding or removing weights. ...

Еще в разделе: (Показать все результаты (>414) - chronos.msu.ru/ )

• GENERATING FLOWS AND A SUBSTITUTIONAL MODEL OF SPACE-TIME
• A. P. LEVICH, A. V. SOLOV’YOV. CATEGORY-FUNCTOR MODELLING OF NATURAL SYSTEMS
• NON-STANDARD ANALYSIS OF NON-CLASSICAL MOTION

... 001.89:004 .. , .. , .. , .. , .. , .., .. e-mail: kryukov@theory.sinp.msu.ru RESTFUL-- 2012-4/882 RESTful-- , : , , , UNIDATA Common Data Model, , , , , , . ... NCEP/NCAR [1], , ). , . ... RESTful-- , : , , , UNIDATA Common Data Model [2], , , , , , . ... UNIDATA Common Data Model (CDM) [2]. ... UNIDATA CDM 3. ... XML . ... Unidata Common Data Model. : http://www.unidata.ucar.edu/software/netcdf-java/CDM/ [3]. ... Network Common Data Form (NetCDF). : http://www.unidata.ucar.edu/software/netcdf/ [5]...

Еще в разделе: (Показать все результаты (>5) - sinp.msu.ru/ )

• http://sinp.msu.ru/en/system/files/preprints/pp-870.pdf

... THE PARALLELIZATION OF COMPUTATIONAL ALGORITHMS IN LARGE PHYSICS PROBLEMS ON MULTIPROCESSOR COMPUTER SYSTEM CONTAINING THOUSAND AND MORE OF PROCESSOR ELEMENTS REQUIRES SPECIAL TOOLS. ... THE GENETIC ALGORITHM CAN BE CHARACTERIZED BY THE FOLLOWING PARAMETERS: - coding strategy, - population size, - initialisation strategy, - selection technique, - crossover mechanism, - mutation mechanism, - strategy for offspring inclusion. ... The results are presented on the following figure. ...

Еще в разделе: (Показать все результаты (>68) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/litinski/litinski.doc
• http://acat02.sinp.msu.ru/presentations/huhlaev/Metamake.doc
• http://acat02.sinp.msu.ru/presentations/medvedeva/Article.doc

Dmitriy Mendeleev . ... Dmitry Ivanovich Mendeleev : A project of undergraduate students from School No.470 (St.Petersburg) . ... Brokhaus Online: Biography of Mendeleev in Russian . ... Original Periodic Table by Mendeleev . ... Mendeleev's "Principles of Chemistry" (4 Pts. in 2 Vols) . ... Mendeleev's house museum in the village Boblovo, Moscow region (in Russian) . Statue of Mendeleev in front of Chemistry Department at Moscow State University (from the article about Russian chemistry in Chem. ...

Еще в разделе: (Показать все результаты (>154) - www.chem.msu.ru/ )

• Intuitive Chemical Topology Concepts

... Другие названия журнала: PHOSPHORUS SULFUR AND SILICON AND THE RELATED ELEMENTS , Phosphorus, Sulfur, and Silicon and the Related Elements , Phosphorus, Sulfur, and Silicon and the Related Elements, . ... Cherepakhin Valeriy S. , Zaitsev Kirill V. , Churakov Andrei V. , Oprunenko Yuri F. , Zaitseva Galina S. , Karlov Sergey S. в журнале Phosphorus, Sulfur and Silicon and the Related Elements , издательство Taylor & Francis (United Kingdom) DOI . ...

Еще в разделе: (Показать все результаты (>3216) - istina.msu.ru/ )

• Grytsiv Andriy - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Kaldarar H. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Journal of Trace Elements in Medicine and Biology - журнал | ИСТИНА -

Pleistocene Climatic Records of East and Central Asia Based on Micromorphological and Mineralogical Indicators of Loess-Paleosol Sequences . ... It is therefore necessary to study the sequences of processes in buried soils to provide information about pedogenesis as well as diagenesis. ... The loess-paleosol sequences of the Luochuan section, Shaanhi, China and of the Karamaydan and Chasmanigar sections in the Tajik Depression are well comparable especially for the Brunches chron. ...

Еще в разделе: (Показать все результаты (>176) - www.fadr.msu.ru/ )

University Satellites and . Space Science Education . ... SYSTEM OF MEASUREMENT OF THE CHARGE S/C Foton-M #2 . ... The charging of the space vehicles and their elements leads to failures of an electric equipment. ... The charging of S/C occurs as a result of influence on its surface of some the factors, in particular surrounding space plasma and solar electromagnetic radiation. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>6702) - cosmos.msu.ru/ )

Approximation of Abstract Differential Equations . ... This review paper is devoted to the numerical analysis of abstract differential equations in Banach spaces. Most of the finite difference, finite element, and projection methods can be considered from the point of view of general approximation schemes. ... The qualitative theory of differential equations in Banach spaces is presented in many brilliant papers and books. ...

Еще в разделе: (Показать все результаты (>122) - srcc.msu.ru/ )

• M. Li, S. Piskarev. On the approximation of integrated semigroups // Taiwanese
• Tatiana V. Amotchkina, Sebastian Schlichting, Henrik Ehlers, Michael K.

... Key carbonatite localities that have been investigated as part of INTAS project 05-1000008-7938 ‘ Diamond and Graphite in Carbonate Magmas ’ are: (1) Western Greenland, where the distribution of kimberlites , lamproites and carbonatites is correlated with depth to a fossil subducted slab (personal communication, Nielsen 2008); (2) the Chagatai Complex of ... Generation of carbonatitic melt through partial melting of carbonated eclogite under mantle conditions. ...

Еще в разделе: (Показать все результаты (>740) - geo.web.ru/ )

• http://geo.web.ru/conf/alkaline/2009/Lapin2.htm
• http://geo.web.ru/conf/alkaline/2009/Savva_Belyatsky.htm
• http://geo.web.ru/users/pavel/Publications/2003/EAE03-J-13291.pdf

... When embedded within a base document, a URL in its absolute form may contain a great deal of information which is already known from the context of that base document's retrieval, including the scheme, network location, and parts of the url-path. ... Introduction This document describes the syntax and semantics for "relative" Uniform Resource Locators (relative URLs): a compact representation of the location of a resource relative to an absolute base URL. ... 3.1) Base URL embedded in the | ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2396.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1945.txt

MATHEMATICAL MODELLING - ADVANTAGES AND SHORTAGES Novoseltsev V.N., Novoseltseva Zh.A. Inst. of Control Sci., ... The shortages of the mathematical modelling are discussed seldom. ... Novoseltsev V.N. Mathematical modeling in biology: systemic which are able to live and die // Automation and Remote control. ... Novoseltsev V.N. Modelling of natural technologies of the organism for a study of its living activity control // Automation and Remote control. 1992. 12. . ...

Еще в разделе: (Показать все результаты (>243) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc15810/doc.pdf
• http://www.mce.biophys.msu.ru/archive/doc21728/doc.pdf
• http://www.mce.biophys.msu.ru/archive/doc184164/eng.pdf

Russian . Next: DSP bard program downloading Up: Additional commands Previous: Additional commands Contents Index . To move the sample on the Z-axis fast (it may need in the end of the work, for example) use SPM/ Move sample menu command. This command allow to move the sample up (to the probe) or down (from the probe) at specified value. Russian . Next: DSP bard program downloading Up: Additional commands Previous: Additional commands Contents Index Filonov 2005-02-04

Еще в разделе: (Показать все результаты (>122) - www.spm.genebee.msu.ru/ )

• Reconstruction of 3D Images
• Median filtering

... Russian: ps 2 pages . Published in: Russian Math. Surveys 57 (2002), no.3. ... English: ps (gzipped) 41 pages . ... Finitely presented groups and semigroups in knot theory. Russian: ps (gzipped) tex . English: ps (gzipped) tex . ... Russian: ps (gzipped) English: ps 20 pages . arXiv.org e-Print archive: http://arXiv.org/abs/math.RA/0205042 . ... Russian: ps English: ps 11 pages . ... In this paper we introduce and study gauge-equivariant $K$-theory groups $K_\GR^i(Y)$. ...

Еще в разделе: (Показать все результаты (>170) - higeom.math.msu.su/ )

• C*-algebras: Talks
• Publications (Russian)
• Abstracts (Russian)

Described below are two methods for preparing input files with basis sets and ECPs which are not currently built in. ... Put basis sets and ECPs in directories (called here def2_svp_BAS and def2_ecp_ECP but you can call them whatever you want) and copy them to the Firefly directory. ... Both methods can also be used for preparing gamess (us) files - the check runs may not terminate properly due to certain keywords, but a useable file called 'input' is normally generated. ...

Еще в разделе: (Показать все результаты (>80) - classic.chem.msu.su/ )

• Firefly DOCUMENTATION - command line arguments
• PC GAMESS/Firefly DOCUMENTATION - Density Functional Theory
• PC GAMESS/Firefly DOCUMENTATION - two-electron integrals precision

... The main problem is increasing the recognition rate of some recognition engines, working in some restricted domains, such as telephone time-table question-answer systems and so on. ... Our algorithms allow user to get recognition variants, which are right sentences in some formal language. ... We suppose that BRE can produce a set of recognition variants in the form of the "complex chain". ... Length of complex chain is the number of vertexes in its graph. ... const*n^2 . ...

Еще в разделе: (Показать все результаты (>76) - www.intsys.msu.ru/ )

• Intelligent Systems :: Staff :: Zolotykh Andrej Alexeevich
• Интеллектуальные системы :: Сотрудники :: Гасанов Эльяр Эльдарович :: Instantly
• Интеллектуальные системы :: Сотрудники :: Золотых Андрей Алексеевич

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2002_1.pdf
• http://rnp-group.genebee.msu.su/pdfs/febsz.pdf

fitshdr - FITS-file headers manipulation tool fitshdr [options] [FITSfile_name] . ... fitshdr [options] --edit FITSfile_name . ... If You want to modify headers of FITSFILE using new FITS-header lines from HEADER file (or from stdin), You have to use this option (You can skip this option, if -H or --header option is used). ... Empty header lines are not displayed (in 'dump' mode only). --line-offsets . ... In 'dump' mode: file offset will be displayed for each header line. --no-line-offsets . ...

Еще в разделе: (Показать все результаты (>262) - lnfm1.sai.msu.ru/ )

• Manpage of FITSHDR_EDIT
• Trudy GAISH, vol. LXV, 1996, Abstracts in English
• Speckle polarimeter

... Methods for non-uniform illumination correction, blood vessel detection and macula and optic disc segmentation, finding dark and light spots in the macula area are suggested. ... CONCLUSION The proposed in the paper algorithms for non-uniform illumination correction, blood vessel detection, macula and optic disc segmentation in retinal images, finding light and dark spots in the macula area compose the basis of the telemedicine system of retinal image analysis developed by the authors group. ...

Еще в разделе: (Показать все результаты (>416) - imaging.cmc.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2011.Graphicon.Zipa_Ignatenko.MetallicCoating.en.pdf
• http://imaging.cs.msu.ru/pub/2011.Graphicon.Lebedev_Ignatenko.Light.en.pdf
• Publications | Laboratory of Mathematical Methods of Image Processing