... Registration and Abstract submission are open for the International Conference on Physics Education ICPE 2014 , that will take place at the Sheraton Cordoba Hotel & Convention Center, C rdoba, Argentina, on August 18th to 22th, 2014. ... Keynote Speaker: Cedric Linder , Professor of Physics Education Research, Division of Physics Education Research, Department of Physics and Astronomy, Uppsala University, Sweden. ... Prof. Zulma Gangoso (Chair) . ... Prof. Zulma Gangoso (Argentina) . ...

Еще в разделе: (Показать все результаты (>42) - foroff.phys.msu.ru/ )

... There are two methods of describing plant associations of the lake-shore: visual and analytical. ... We analyzed each lake separately with help of cluster analysis (Manchattan distance, Ward method). ... Besides, cluster analysis only for common plant species was performed. ... All common species on this lake form one multitudinous cluster (fig. 5), except for Comarum palustre and Equisetum fluviatile (the same group of species reveled by cluster analysis for common species from other lakes). ...

Еще в разделе: (Показать все результаты (>214) - herba.msu.ru/ )

• Wakehurst Place, April 2003

... Department . ... Alexander Pozdneev at the ASMS 2008 Conference . ... The 56th ASMS Conference on Mass Spectrometry took place in Denver (CO, USA), June 1-5, 2008. ... International conference "Mass Spectrometry and Allied Topics" is an annual meeting of the American Society for Mass Spectrometry (ASMS). Approximately 7000 scientists attended this conference, and over 3000 research papers have been presented in 2008. ... 2008?2016 ASR Department , CMC Faculty , Lomonosov MSU . ...

Еще в разделе: (Показать все результаты (>8) - ani.cmc.msu.ru/ )

• Alexander Pozdneev at the ASMS 2008 Conference

... О UNИX . ... RstPrimer . ... A ReStructuredText Primer ========================= :Author: Richard Jones :Version: $Revision: 1.17 $ :Copyright: This document has been placed in the public domain.. contents:: The text below contains links that look like "(quickref__)". ... The underline/overline must be at least as long as the title text. ... To indicate the document title in reStructuredText, use a unique adornment style at the beginning of the document. ...

Еще в разделе: (Показать все результаты (>180) - uneex.mithril.cs.msu.su/ )

• HelpOnInstalling/TroubleShooting - UNИX
• HelpOnThemes - UNИX
• Meetings/Murray - UNИX

Summary of the oriented time theory (TTO). ... Only then the time properties of the "axioms" will turn into "theorems". ... OTT rests on two grounds, that bind space and matter: 1) the time is one of the dimensions of space-time continuum and has the properties of a vector: direction and dimension; 2) for a solid body in the inertial state in a homogeneous isotropic space, an objective indicator of the direction change of the vector of time is the emergence of inertial force. ...

Еще в разделе: (Показать все результаты (>424) - chronos.msu.ru/ )

• GENERATING FLOWS AND A SUBSTITUTIONAL MODEL OF SPACE-TIME
• A. P. LEVICH, A. V. SOLOV?YOV. CATEGORY-FUNCTOR MODELLING OF NATURAL SYSTEMS
• A SEARCH FOR MAXIMUM SPECIES ABUNDANCES IN ECOLOGICAL COMMUNITIES UNDER

... NASA's newest Great Observatory, the Chandra X-Ray Observatory (CXO) -- formally known as the Advanced X-Ray Astrophysics Facility (AXAF) -- launched on July 23, 1999 and represents such an advance. ... Hughes Danbury Optical Systems (HDOS), now Raytheon Optical Systems Incorporated, figured and polished the x-ray optics; Optical Coating Laboratory Incorporated (OCLI) coated the polished optics with iridium; and Eastman Kodak Company (EKC) mounted and aligned the optics and provided the optical...

Еще в разделе: (Показать все результаты (>424) - xray.sai.msu.ru/ )

• The X-ray Optics
• DHTML Kitchen: Tabs

MGU Botanic Garden . ... The MSU Botanical Garden is not only a valuable scientific institution, but also a place giving joy and a good mood to many people. ... To become a volunteer, please, fill in the application e-form and send it to the following e-mail address: . ... We will contact you on your telephone number within a week of your sending the application. Community work days are also held on the territory of the Garden for different organization and agency workers. ...

Еще в разделе: (Показать все результаты (>6) - botsad.msu.ru/ )

... Manuscripts are classified in size into the three categories: . ... The most stringent requirements are imposed on manuscripts of the first category. ... Manuscripts of the second category should contain a representation of main results without excessive details in conclusions and proofs. ... Manuscripts should be prepared in electronic form using LaTeX 2.09 (see the instructions for manuscript preparation in electronic form) . ... The manuscript should be signed by its author(s). ...

Еще в разделе: (Показать все результаты (>108) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник

MATSYM - symbolic matrix processor . ... To use the program you will need a MAT file (liked CIR file: "User manual for CIRSYM program") of your system. ... In first string of MAT file enter any text you want to be the title of your system. ... Starting from string 2 (if is not comments - "*") enter the system element name, incident row and column and, optionally, its value. ... To generate a solution, run MATSYM.exe and enter "system_file_name.CIR" or click on the "ENTER" (in "MAT" case). ...

Еще в разделе: (Показать все результаты (>14) - astrometric.sai.msu.ru/ )

• Specification

... Issues of the year 2010 . ... Instructions for Authors . ... The scientific English language journal ?GEOGRAPHY, ENVIRONMENT, SUSTAINABILITY? aims at informing and covering the results of research and global achievements in the sphere of geography, environmental conservation and sustainable development in the changing world. ... In the text the surname of the author and the year of publication of the reference should be given in square brackets, i.e. [Author1, Author2, 2008]. ...

Еще в разделе: (Показать все результаты (>307) - www.geogr.msu.ru/ )

LIPSKIY-RODIONOVA' LUNAR ANTIPODES AS PRECURSORS OF A REGULAR WAVE PLANETOLOGY G.G.Kochemasov IGEM of the Russian Academy of Sciences, Moscow, Russia kochem@igem.ru / Fax: (009)(095)230 21 79 The first observations of the lunar far side allowed to compare it with the near side and draw very important conclusions in the very beginning of planetary studies based on spacecrafts. ... Celestial bodies are dichotomic. ... The concept of celestial bodies includes Sun (a star) as one of them. ...

Еще в разделе: (Показать все результаты (>102) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Symposium/lipskiy.doc
• http://selena.sai.msu.ru/Chik/Publications/ms40/17_Chikmachev_etal.pdf

... The CLEOR/Europe-EQEC 2005 Conference will take place from 12 to 17 June 2005 at the International Congress Center Munich, Germany . ... Conferences Manager . ... CLEO(R)/Europe-EQEC 2005, Conference on Lasers and Electro-Optics and European Quantum Electronics Conference, 12-17 June 2005, Munich, Germany www.cleoeurope.org . ... Launch Conference of the International Year of Physics, 13-15 January 2005, Paris (Unesco), France - Open Meeting . ...

Еще в разделе: (Показать все результаты (>119) - ilc.phys.msu.ru/ )

... The CLEOR/Europe-EQEC 2005 Conference will take place from 12 to 17 June 2005 at the International Congress Center Munich, Germany . ... Conferences Manager . ... CLEO(R)/Europe-EQEC 2005, Conference on Lasers and Electro-Optics and European Quantum Electronics Conference, 12-17 June 2005, Munich, Germany www.cleoeurope.org . ... Launch Conference of the International Year of Physics, 13-15 January 2005, Paris (Unesco), France - Open Meeting . ...

Еще в разделе: (Показать все результаты (>170) - ofvp.phys.msu.ru/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... как в матлабе записать квадратную матрицу в файл тхт? . ... Re: как в матлабе записать квадратную матрицу в файл тхт? [ re: Demandeur ] . ... attribute and its value. ...

Еще в разделе: (Показать все результаты (>5982) - www.snto-msu.net/ )

• Выделение прямоугольной области в редакторе - Public forum of MSU united
• emacs: roman numerals -> arabic numerals in regexp-replace - Public forum of
• Matrix Reloaded and Fifth Element HDTVRip - Public forum of MSU united student

. [ Войти ] . Главная -> Фильмы -> Hidden Places . Пользователи . Демо . Деньги . Фильмы . Форум . Hidden Places . США 2006 . отметить . Мелодрама . Драма .

Еще в разделе: (Показать все результаты (>589) - kinfo.ru/ )

• In a Lonely Place - Фильмы - Kinfo.ru
• The Last Place on Earth - Фильмы - Kinfo.ru
• Right Place, Wrong Time - Фильмы - Kinfo.ru

... Mon, 07 Feb 2011 21:46:43 +0300 . Daniil Alexeyevsky . Replaced all calls to obsolete Alignment.to_fasta() with Alignment.to_file() . ... Replaced all calls to obsolete Block.flush_left() with Block.flush("left") . ... Replaced calls to obsolete Alignment.from_file() with Alignment().append_file everywhere . Fri, 21 Jan 2011 15:00:23 +0300 . ... Wed, 19 Jan 2011 16:10:27 +0300 . ... Fri, 17 Dec 2010 00:45:20 +0300 . ... Added usecases from wiki to test/ directory . ...

Еще в разделе: (Показать все результаты (>15833) - kodomo.fbb.msu.ru/ )

• allpy: 94079e6a666a NEWS
• allpy: 026440428507 NEWS
• allpy: log

... The single password sign will be replaced by the more superior two factor authentication as it is becoming increasingly easy to crack a four or five character password within a few minutes using password cracking tools. ... The tool cracks any password of up to seven alphanumeric characters (lower and upper case) in a matter of seconds, with a 99.97% success probability. ... ray ban outlet uk . ... http://projahn.by/cheap-ray-bans-internet-professionals . ...

Еще в разделе: (Показать все результаты (>157) - elana.sinp.msu.ru/ )

• editor | С Днем Победы!
• cheap michael kors Cyclacel Pharmaceuticals? CYCC CEO Spiro Rombotis on Q2 2015

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>193) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• MUSCLE 3.6

... Probe flash (energy/duration) . ... 0.01 J / 0.01 ms . ... Submersible unit (dimension/weight) . Power supply unit (dimensions/weight) . ... 300 x 300 x 50 mm / 1 kg . ... Power supply . ... The complete set of PrimProd fluorometer consists of the following mainframes: submersible probe, 12 DC on-board block power supply, IBM-compatible computer, connecting cables and cable-rope. ... Submersible probe. ... On-board power block provides the necessary voltage (42 V) supply at the submersible probe. ...

Еще в разделе: (Показать все результаты (>11) - www.biophys.msu.ru/ )

... Математический семинар Глобус, заседание 21 декабря 2006 г. В четверг, 21 декабря 2006 года, в 15:40 в конференц-зале НМУ, Б. Власьевский 11, состоится доклад: Topics in max-plus or tropical spectral theory. ... One of the main motivations of max-plus spectral theory is the classical spectral theory, since the max-plus eigenproblem can be obtained as the limit of a deformation of the classical eigenproblem. ... I will discuss max-plus spectral problems over a non-compact spate space. ...

Еще в разделе: (Показать все результаты (>179) - www.mmonline.ru/ )

• Конференция Geometry and Integrability in Mathematical Physics