... Devitrification of glass with the cation ratio, corresponding to the {Bi2.18Sr2CaCu2Ox+0.4Sr1.7Ca1.3Al2O6} composition, was studied. ... Above 600 o C, Bi-2212 and (Sr,Ca)3Al2O6 formed simultaneously, so that at 750 o C, the two-phase composite Bi-2212 - (Sr,Ca)3Al2O6 was obtained that contained grains of the aluminate phase 0.03-0.3 micron in size. ...

Еще в разделе: (Показать все результаты (>589) - chem.msu.ru/ )

• The anomalous behaviour of the non-selective ionisation signal pulse under
• Nonselective reduction of AgBr emulsion. Correlation between concentration of
• Moscow University Chemistry Bulletin Vol. 49, No. 4, P. 251 (2008)

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>166) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.8 Services
• GeneBee BLAST 2.2.22+ Services

... Supercomputing Technologies in Science, Education and Industry Almanac Series . ... DRIVER: To develop a model of the interstellar hydrogen distribution in the heliosphere. To apply this model for the analysis of experimental data from different spacecraft. ... The results of the simulations of the formation and evolution of molecular clouds can be used as initial conditions for the current star formation in galaxies. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>38) - hpc.msu.ru/ )

Doklady Biological Sciences, Vol. 375. 2000, pp. ... GENERAL BIOLOGY Specific Structural Features of the Pectoral Arch and Phylogenetic Relations in Some Mammalian Taxa S. V. Fomin and V. S. Lobachev Presented by Academician I.A. Shilov March 6, 2000 Received March 6, 2000 Reorganization of the pectoral arch has played an important role in mammalian evolution. ... Thus, the formation of two types of pectoral arch in the modern families of Lagomorpha could only have occurred through divergence. ...

Еще в разделе: (Показать все результаты (>75) - vertebrata.bio.msu.ru/ )

• http://zmmu.msu.ru/morphology/library/Dzer_Korzoun_2004.pdf
• http://vertebrata.bio.msu.ru/Sokolov2.pdf
• http://vertebrata.bio.msu.ru/MOLBIOL_2007_Raddei_eng.pdf

... Measurement of B-type natriuretic peptide by two assays utilizing antibodies with different epitope specificity. ... DESIGN AND METHODS: Plasma samples (n=94) from HF patients were analyzed by the novel-type "Single Epitope Sandwich" (SES assay prototype) and the conventional-type Siemens ADVIA Centaur BNP assays. ... RESULTS: The SES assay measured 1.2- to 7.2-fold (2.1+/-0.9; mean, SD) greater BNP concentrations compared to the Siemens assay. ...

Еще в разделе: (Показать все результаты (>100) - biochem.bio.msu.ru/ )

• Attempt to optimize some properties of fluorescent chimeras of human small heat
• [Different domain organization of two main conformational states of
• Chaperone-like activity of monomeric human 14-3-3zeta on different protein

... The Evolution of the Russian Tax System in the 19thcentury, . ... Ezhegodnik (Economic Hystory. ... 2002 , Moscow: ROSSPEN, 2003, p.345-383. ... The article deals with the history of the taxes of the Russian empire in the 19th century. ... Despite of the lag with the European model which consisted in the absence of income taxation, the Russian tax system had provided the budget with monetary resources, that were necessary for the financial stability of the Empire. ...

Еще в разделе: (Показать все результаты (>131) - hist.msu.ru/ )

• Project "The Labour Relations Evolution in Russian Industries"
• International Summer School - 2012: ?Russian History: Politics, Culture & Art?
• The Impact of Orthodox and Western Christianity on Societies

... Shock Wave Evolution in the Non-Equilibrium Fluctuating Media . ... The evolution of the shock wave in the non-equilibrium plasma is usually connected with development of Rayleigh instability. ... For description of weak shock waves evolution in the non-equilibrium fluctuating media we are used the standart system of nonlinear acoustics for relaxed media up to second order of the theory of perturbances. ... In the each different spectral diapason this system is reduced to one equation. ...

Еще в разделе: (Показать все результаты (>207) - acs366.phys.msu.su/ )

• Abstract (Invited)

DISSIPATIVE STOCHASTIC DYNAMIC MODEL OF LANGUAGE SIGNS EVOLUTION Poddubny V., Polikarpov A. 1 Tomsk State University, 36, Lenina Av., ... ASP is measured by the maximum amount of possible meanings acquired by a sign during all its life-span. ... The next question appears: what mathematical model of the process of the language sign evolution forecasts the momentary polysemy distribution, identical to the empirical distributions, got, for instance, from representative explanatory dictionaries? ...

Еще в разделе: (Показать все результаты (>172) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc62362/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc27224/doc.pdf
• http://www.mce.biophys.msu.ru/archive/doc151854/eng.pdf

... Graduate student, School of Public Administration, Lomonosov Moscow State University. ... An analysis of evolution of different theoretical approaches to public policy has shown that there was transition from consideration of actors of decision-making process as a cohesive group (elite) to revealing separate groups of influence (groups of interests), and then to specification of small formations (triangles, networks, coalitions), pursuing private interests and purposes. ... Public Administrarion". ...

Еще в разделе: (Показать все результаты (>124) - ee-journal.spa.msu.ru/ )

... MSU Codec Comparison aims to deliver high quality comparisons of video encoders to both industrial and scientific communities. ... The newest versions of MPEG-4 codecs comparison for their using by an ordinary user for home video compression. ... First Annual MPEG-4 AVC/ H.264 Video Codecs Comparison (January 2005) . ... Second Annual MPEG-4 AVC/H.264 Video Codecs Comparison(December 2005) . ... Third Annual MPEG-4 AVC/H.264 Video Codecs Comparison (December 2006) . ... Fifth H.264 codecs comparison...

Еще в разделе: (Показать все результаты (>166) - graphics.cs.msu.ru/ )

• MSU Video Codec Comparison | Лаборатория компьютерной графики и мультимедиа

... Classification of the engineering geological Earth's structures and their characteristic (Project manager – Prof. Trofimov V.T.; investigator – Ass. ... Artificial soils as a result of technogenesis (Project manager - Prof. Trofimov V.T.; investigator - Ass. ... Tgheoretical problems of evolution of engineering geological Earth's conditions at the epoch of technogenesis (Project manager - Prof. Trofimov V.T.; investigator – Senior Research Worker Kyrinov M.B.); . ... Project manager . ... 1998-2000 ...

Еще в разделе: (Показать все результаты (>85) - www.geol.msu.ru/ )

• Department of Lithology and Marine Geology - Laboratories
• Faculty of Geology >> Departments

LOCAL TSUNAMI WARNING AND MITIGATION ________________________________________________________________________________________________________________________________________ AMPLITUDE EVOLUTION AND RUNUP OF SOLITARY WAVES ON A SLOPING PLANE Ahmet . ... 1999]; Carrier and Yeh, [2002]. ... Experimental data on runup of solitary waves are given among others by Hall and Watts, [1953], Pedersen and Gjevik, [1983] and Synolakis [1987], Shankar and Jayaratne, [2002], Lee and Raichlen, [2002]. ...

Еще в разделе: (Показать все результаты (>21) - seac47-2.phys.msu.ru/ )

Next: Tuning the Transmission Protocol Up: UUCP Low-Level Protocols Previous: UUCP Low-Level Protocols . As UUCP is used over different types of connections, such as serial lines or TCP, or even X.25, specific low-level protocols are needed. ... Sometimes, sending eight-bit characters over a serial connection is impossible, for instance if the connection goes through a stupid terminal server. ... This is the case for all TCP connections, as well as for most modem connections. ...

Еще в разделе: (Показать все результаты (>349) - itpm.msu.su/ )

• Different Streaks of Development
• Request Processing in Apache 2.0 - Apache HTTP Server
• The buffer cache

... Ivanovo State University . My experience as a Fulbright scholar in the USA gave me an ample opportunity to compare the structure, functions and modes of self-identification in the US and Russian academic communities. Overall, the American university system seemed more flexible and capable of self-adjusting to the demands of the moment. ... Though Russia is far behind the USA in technology and electronic media, we still can adopt some American educational technologies. ...

Еще в разделе: (Показать все результаты (>99) - www.prof.msu.ru/ )

• FOREIGN LANGUAGES AND CULTURE EDUCATION THROUGH THE DIALOGUE OF CULTURES
• Training For Effective Intercultural Communication

... All the galaxies are divided into 4 groups depending on the environment type; every subsample contains more than 10 galaxies. ... An effect of environments is seen both for the nuclei and for the bulges: if we consider the clusters (Virgo and Ursa Ma jor) and group centers as dense environments and the field and group periphery as sparse environments, then in the dense environments the stellar populations of S0s are in average older by 4­5 Gyr than in the sparse ones. ...

Еще в разделе: (Показать все результаты (>48) - sn.sai.msu.ru/ )

• http://sn.sai.msu.ru/~sil/preprints/iau245sil.pdf
• http://sn.sai.msu.ru/~sil/preprints/iau254sil.pdf
• http://sn.sai.msu.ru/~sil/preprints/sil_pulk.pdf

Nominal modification at the Syntax-Semantics Interface: comparing attributive adjectives in Italian and English In his seminal work, Bolinger (1967) discusses an asymmetry between two functions that adjectives can perform, namely attributive and predicative modification; furthermore, he points out that the syntactic asymmetry between the pre- and the post-nominal position of a number of adjectives in English is related to a semantic difference between reference- and referentmodification, respectively. ...

Еще в разделе: (Показать все результаты (>266) - www.philol.msu.ru/ )

• MSU-LGCLL:: Curriculum Vitae of Anatoliy Anatolyevich Polikarpov
• Московское типологическое общество :: МГУ :: Филфак :: ОТиПЛ

... G. A Leikin, A. N. Sanovich. Sternberg Astronomical Institute, Moscow 119899, Russia. Brown University - Vernadsky Institute Microsymposium 34, October 8-9, 2001, Moscow, Russia . ... G. A. Leikin and A. N. Sanovich, Sternberg State Astronomical Institute, Moscow State University, . ... Brown University - Vernadsky Institute Microsymposium 38, October 27-29, 2003, Moscow, Russia . ... Sternberg State Astronomical Institute, Moscow, State University, 119992, Moscow, Universitetskij prosp. ...

Еще в разделе: (Показать все результаты (>103) - selena.sai.msu.ru/ )

• Санович А.Н.
• Vladimir V. Busarev

High Energy Physics and Quantum Field Theory XXI International Workshop Saint Petersburg Area, June 23­30, 2013 The Influence Functional approach to the quantum systems dynamics Alexander Biryukov, Mark Shleenkov Samara State University The paper structure 1. Model QS+EMF 2. ... Quantum transition probability as a paths integral of real functional 5. ... Quantum transition probability as a paths sum of real functional The energy representation is more convenient for numerical calculations. ...

Еще в разделе: (Показать все результаты (>136) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/qfthep2010_dubinin.pdf
• http://qfthep.sinp.msu.ru/talks/Ginzbinerttr100909.pdf
• http://qfthep.sinp.msu.ru/talks/QFTHEP2010Dolgopolov.pdf

... Студенческая Астрономическая обсерватория ГАИШ . ... Структура ГАИШ : Отдел внегалактической астрономии : . ... For those really interested in galaxies, extragalactic astronomy or the aspects of cosmology we study, we can always find an interesting problem to work on. ... To make your work in the Group most effective, it would be useful to study the following courses read by our group members as well as the members of other groups in our and other institures. ... Student information . ...

Еще в разделе: (Показать все результаты (>15) - www.sai.msu.ru/ )

HBT 10 .. 2015 - ALICE LHC- QGP, QGP 1 fm/c 5 fm/c 10 fm/c 50 fm/c " " - . ... Rout / Rside ~ sensitive to emission duration. ... Rout/Rside 1 ALICE - Phys.Lett.B696:328-337,2011 Heavy Ions STAR and ALICE, 200 and 2760 GeV · All the expected trends are observed: ­ Overall increase of the radii as compared to RHIC ­ Strong dependence of the radii on kT ­ Rout/Rside ratio even smaller than the one at RHIC 04/11/2011 P. Boek,Phys.Rev. C83 (2011) 044910 3D relativistic viscous hydrodynamics. ...

Еще в разделе: (Показать все результаты (>50) - lav01.sinp.msu.ru/ )

• Sergey Petrushanko PHOTOS from the different events