It is now possible to specify multiple log files, each with a fully customizable format. ... Multiple log files are implemented as part of the mod_log_config module which as of Apache 1.2 is the default log module. Multiple log files be created with either the TransferLog or CustomLog directive. These directives can be repeated to create more than one log file (in previous releases, only one logfile could be given per server configuration). ... Syntax: CustomLog filename "format" . ...

Еще в разделе: (Показать все результаты (>50) - neptun.sai.msu.ru/ )

• Compiling and Installing Apache
• Configuring Multiple IP Addresses
• Using Apache with HP MPE/iX

Создание и использование закрытого и открытого ключа в программе putty %TOC% ---++ Введение Для общего понимания ключей рекомендуется прочитать [[SShKeys][страницу посвященную ssh-ключам]] В примерах ниже мы будем для определенности использовать RSA-ключи, хотя Вы можете использовать и другие виды ключей ( puttygen умеет еще и DSA) ---++ Создание putty- ключа Для этого требуется запустить программу puttygen : img alt = puttygen -start.PNG Двигать мышкой надо пока ключ не будет создан. ...

Еще в разделе: (Показать все результаты (>4994) - wiki.cmc.msu.ru/ )

• (r5) SSHKeyGenUsePuTTY < Main < Foswiki
• (r4) SSHKeyGenUsePuTTY < Main < Foswiki

... Handling file uploads . ... Multiple files can be uploaded using different name for input . ... form action="file-upload.php" method="post" enctype="multipart/form-data"> Send these files:<br> <input name="userfile[]" type="file"><br> <input name="userfile[]" type="file"><br> <input type="submit" value="Send files"> </form> . ... In this case, $HTTP_POST_FILES['userfile']['name'][0] would contain the value review.html , and $HTTP_POST_FILES['userfile']['name'][1] would contain the value xwp.out . ...

Еще в разделе: (Показать все результаты (>277) - oit.cmc.msu.ru/ )

• Unix/HP-UX installs
• header
• Compiling and Installing Apache

... Тем не менее, некоторые файлы, имеющиеся здесь, могут представить интерес и для тех, кто не является пользователем HCh. Все программы имеют англоязычный интерфейс. ... HCh для DOS . ... Руководство пользователя программы Unitherm, предназначенной для ведения базы данных и расчета термодинамических свойств веществ . ... Руководство пользователя программы Main, предназначенной для подготовки файлов исходных данных для термодинамического моделирования и обработки результатов расчетов . ...

Еще в разделе: (Показать все результаты (>89) - www.geol.msu.ru/ )

• Software for resistivity and induced polarization

... A procedure for calibrating fits images from Ondrejov Multichannel Flare Spectrograph. Download CALIB.PRO . Download HALPHA.TAB . ... A procedure for extracting profiles from FITS files. ... Version of the program calibration: 12.3 for windows + SSW ( SolarSoft is a set of integrated software libraries, data bases, and system utilities which provide a common programming and data analysis environment for Solar Physics.) ... Download ASTROLIB.ZIP Here you can download library for fits files. ...

Еще в разделе: (Показать все результаты (>285) - lnfm1.sai.msu.ru/ )

• SOFTWARE HSFA 2
• Marat Abubekerov - My scientific publications

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>17) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/mol_biol_mosk_2006.pdf

... Study . ... SPDC Laboratory . ... Катамадзе К. Г. Управление частотно-угловым спектром бифотонного поля (2013). Download: 2013-7-k_g_katamadzje.pdf (8.1 MB) . Страупе С. С. Корреляционные свойства квантовых состояний высокой размерности на основе бифотонных полей (2011). ... Управление спектром пространственных мод бифотонного поля (2014). ... Управление частотно-угловым спектром бифотонного поля (2014). ... Патерова А. В. Управление спектром бифотонного поля за счет угловой дисперсии (2013). ...

Еще в разделе: (Показать все результаты (>80) - qi.phys.msu.ru/ )

• Publications :: Quantum Information Laboratory

. Home . Structure of Data . Description . Catalog . Publications . VO . ЮБ 2000 . 11:14:20.2 . ЮД 2000 . -57:33:04 . l . 290.172 . b . 2.895 . diameter . 14.0' . (m - M) 0 . 11.4 0.05 . distance . 1900 50 pc . E(B - V) . 0.08 0.01 . log(t) . 9.65 0.05 . (J, J-H) isochrone VOTable . 2MASS data VOTable . Developed by the Team . Send us your questions or feedback

Еще в разделе: (Показать все результаты (>215) - ocl.sai.msu.ru/ )

• SAI OCL Catalog Berkeley 97
• SAI OCL Catalog Czernik 23
• SAI OCL Catalog Berkeley 72

It is now possible to specify multiple log files, each with a fully customizable format. ... Multiple log files are implemented as part of the mod_log_config module which as of Apache 1.2 is the default log module. Multiple log files be created with either the TransferLog or CustomLog directive. These directives can be repeated to create more than one log file (in previous releases, only one logfile could be given per server configuration). ... Syntax: CustomLog filename "format" . ...

Еще в разделе: (Показать все результаты (>305) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QGroupBox Class
• Qt Toolkit - QGridLayout Class
• Apache module mod_auth

... Peer review | ... Contemporary Sociological Theory and Methodology . Dobren'kov V.I. Methodological and epistemological problems of formation of theoretical knowledge in sociology ( review ) Download PDF . Dugin A.G. Conceptual approaches to the concept of 'civilization' ( review ) Download PDF . ... New trends in the religious consciousness and behavior of Russians ( review ) Download PDF . ... Mchedlova E.M. Sociological interpretation of religious and social ( review ) Download PDF . ...

Еще в разделе: (Показать все результаты (>17) - www.socio.msu.ru/ )

... Химического факультета МГУ . Спецкурсы кафедры химической энзимологии . Программа спецкурса . Биоинформатика - предмет и методы исследований, основные приложения. ... Математические основы выравнивания последовательностей символов. ... Поиск гомологичных последовательносткй ДНК/белков в базах данных. ... Современные методы предсказания вторичной и третичной структуры белков на основе первичной структуры. Метод моделирования по гомологиям. ... Стратегия моделирования структуры белков: . ...

Еще в разделе: (Показать все результаты (>791) - chem.msu.ru/ )

• Применение газовой хроматографии для определения термодинамических
• Department of Chemistry, Moscow State University
• Scientific Programme. Russian XV International conference on chemical

... ZOO is a flexible and powerful content application builder to manage your content. ... ZOO moves from simply being a CCK to an Application Builder. Apps are extensions for ZOO which are optimized for different purposes and types of content catalogs. ... A flexible and powerful content application builder to manage your content. Download ZOO . ... escort beylikduzu bayan escort escort bayan escort escort istanbul escort bayan porno film escort istanbul escort beylikduzu escort bayan ...

Еще в разделе: (Показать все результаты (>6) - physcontrol.phys.msu.ru/ )

... INFORMATION LETTERS . ... XIV International Ornithological Conference of North Eurasia . ... For downloading Information Letters of the Conference choose below : . 1st Information Letter (English) - Download . 1st Information Letter (Russian) - Download . 2nd Information Letter (English) - Download . 2nd Information Letter (Russian) - Download . Information about the Conference is placed in search systems: . http://www.konferencii.ru/ . http://www.science-community.org/ . ...

Еще в разделе: (Показать все результаты (>704) - zmmu.msu.ru/ )

• Russian Journal of Theriology
• XIV International Ornithological Conference of North Eurasia: Registration

Multiple Supernovae in the same galaxy . ... When looking at these images, you should note just how big these galaxies are. ... SN 2009as and sn2009gb images sub-page . ... LOTOSS discovered 2003hl , and a few weeks later JM Llapasset was taking an image of it, and he noticed a new star . ... Supernovae 2002cv and 2002bo in NGC 3190 2002cv was discovered by Campo Imperatore Observatory while observing 2002bo in IR. 2002cv was only visible in IR must likly due to it being behind a dust lane. ...

Еще в разделе: (Показать все результаты (>7) - www.rochesterastronomy.org/ )

... Generation of octree meshes with cut cells in multiple material domains" . Chernyshenko A.Yu. An algorithm for the generation of octree meshes with cut cells generation in complex multiple material domains is proposed. The method of cell cutting is based on the cubical marching squares and multiple material marching cubes algorithms. ... Keywords: octree meshes, cut cells, hexahedral meshes, polyhedral meshes . PDF (in Russian) (1.57MB) . PDF. zip (in Russian) (1.34MB) . ...

Еще в разделе: (Показать все результаты (>52) - num-meth.srcc.msu.ru/ )

• "ALIGNMENT IN FREE DECAYING MHD TURBULENCE"
• Flow simulation by the lattice Boltzmann method with multiple-relaxation times

. Used with its -u option the sort command removes duplicate lines from a file. For example: sort -u -o mail/labels addresses . This removes all duplicate lines from the file addresses and places the output in the file mail/labels . Duplicate lines do not have to be consecutive for the sort command to identify and remove them.

Еще в разделе: (Показать все результаты (>83) - comet.sai.msu.ru/ )

• Printing multiple copies
• Using multiple options
• Examples of using multiple options

Клуб выпускников МГУ (Московский Государственный Университет) . ... Сервис Dropbox позволяет пользователям хранить свои данные на серверах в Интернете и синхронизировать их с любым компьютером. Другими словами, если вы скопируете файл в папку Dropbox, то этот файл появится на всех компьютерах, где установлена программа Dropbox с вашей учетной записью. Преимущества сервиса Dropbox : . ... Поддерживает любой тип файлов . ... Поддерживает публикацию файлов в интернет . ... Зайти на сайт Dropbox . ...

Еще в разделе: (Показать все результаты (>6599) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Доцента МГУ заподозрили в экстремизме

... О UNИX . ... Authenticating against Windows-Domain using SSPI . ... Apache 2.0.xx. ... These instructions assume you've successfully set up a working moin configuration (based on HelpOnInstalling/ApacheOnWin32 ) and you're expanding to include Domain Authentication. a Domain Controller . ... Configuring Apache http.conf file . ... Domain Authentication using mod_auth_sspi.so from MoinMoin.auth.http import http from MoinMoin.auth import moin_session auth = [http, moin_session] user_autocreate = True ...

Еще в разделе: (Показать все результаты (>530) - uneex.mithril.cs.msu.su/ )

• HelpOnImages - UNИX
• HelpOnUpdating - UNИX
• HelpOnSlideShows - UNИX