docs.kde.org . ... Slide Show -> Edit Slide Transition . Apply transition effects to the currently open slide. This is where you can choose how the transition from one slide to the next will be handled. The transition effects you select here are applied on the transition from this slide to the next. Slide Show -> Start . Begin the slideshow from the current slide. Slide Show -> Start From First Slide . ... Go directly to the first slide in the slide show. ... Text Menu? . ...

Еще в разделе: (Показать все результаты (>111) - uneex.lorien.cs.msu.su/ )

• The %files List
• They're Nearly Identical?
• Apache mod_rewrite Technical Details - Apache HTTP Server

Lectures on Nanomagnetism Prof. M. Farle www.unidue.de/agfarle University DuisburgEssen ( Lectures will be given in English with (partial) Russian translation upon request) th Lecture Hall: library of faculty of physics, 5 floor Monday, 24.03.2014 Duration 30 min 15:15 15:45 30 min 15:45 16:15 30 min 16:15 16:45 break 45 min 17:00 ґ 17:45 45 min 17:45 ґ 18:30 Tuesday, 25.03.2014 45 min 15:15 ґ 16:00 45 min 16:00 ґ 16:45 break 45 ...

Еще в разделе: (Показать все результаты (>22) - phys.msu.ru/ )

• http://phys.msu.su/rus/news/latest/Abstract_ter-avetisyan.pdf

Next: Making Objects Persistent Up: Activation Modes Previous: Activation Mode Per Method . All activation modes discussed up until now assume client and server are different programs that run in separate processes. ... The function mico_module_exit() is called just before the module is unloaded from the client and should release all allocated resources: in our example the account object created in mico_module_init() . mico_module_exit() is only called if mico_module_init() returned TRUE . ...

Еще в разделе: (Показать все результаты (>154) - rtm-cs.sinp.msu.ru/ )

• Footnotes
• Qt Toolkit - QGroupBox Class
• Qt Toolkit - QGridLayout Class

We have discussed above the massive vector particle case. The Lagrangian of free massless vector field has got a gauge symmetry. ... On the contrary, in the case of squared diagram technique the extension of polarization states is very useful and has been used in numerous calculations. ... This leads to cumbersome expressions of squared diagram contributions in comparison with the case when the unphysical polarizations are included into the sum. ...

Еще в разделе: (Показать все результаты (>245) - theory.sinp.msu.ru/ )

• [Computer_algebra] Computer algebra seminar (March)
• QED processes
• [RU-NGI] Fwd: [Noc-managers] Updated version of the EGI Acceptable Use Policy -

... After having read the majority of publications on the problem of time, which are numerous, we acquire a grievous feeling that it is being mistreated. ... Eight fundamental properties of time are being considered in this paper. , , , . ... 1949 . ... 1997. . ... 1000 , 2000 3000 н . ... N- ( 2000 < N), , 2000 . ... ZFA, н ZF. ... 3. : ()()( = z(z x z y)). 4. : xyzu(u z u = x u = y). 5. : x(y)z(z y u(u x & z u)). 6. : xyz(z y z x), 11 12 . 1973; . ... ZFAI, 1н10 11н14, , , ( ZFA ZFAI). 11. = . ...

Еще в разделе: (Показать все результаты (>177) - chronos.msu.ru/ )

• http://temporology.bio.msu.ru/EREPORTS/shulman-is_it_possible_to_travel_in_time_eng.pdf
• Russian Interdisciplinary Temporology Seminar
• Dynamic Equilibrium of The Atemporal Universe

... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. November 11, 1997 . The Annotated Galactic Center . ... Constellations of nearby stars include Sagittarius , Libra , Scorpius , Scutum , and Ophiuchus . ... Open clusters include M6 , M7 , M18 , M21 , M23 , M24 , M25 . Globular clusters include M9 , M22 , M28 , M54 , M69 , M70 . ... About APOD > . ... NASA Technical Rep.: ...

Еще в разделе: (Показать все результаты (>4) - www.arcetri.astro.it/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>15) - bioinf.fbb.msu.ru/ )

• RNA Alignment
• SDPlight
• SDPpred

... Finance - Currency Conversion . FXConverter - OANDA's 164 Currency Converter . ... PNAS Online -- Search Multiple Journals . ... Scirus - For Scientific Information Only . Molecular Biology Software . Education and Genetics: Human Genome Project Information . Journal of Computational Biology Table of Contents . LINK Alert Service - Subscribe . Springer LINK - Forum for Science . ... Genome Biol Vol. ... COMPUTATIONAL BIOLOGY . ... Journal Impact Factor 2000 . ...

Еще в разделе: (Показать все результаты (>41) - higeom.math.msu.su/ )

. GMAIL .

Еще в разделе: (Показать все результаты (>3) - astrometric.sai.msu.ru/ )

... Development of a computer-based information system for Russian folklore studies . Computer systems SKAZKA and SKAZKA-2 are developing by A.V. Rafaeva. The aim of this work is to make program tools for structural analysis of folktale plots and motives. ... 112 ? 113; Rafaeva A.V. Analiz rodstvennykh otnoshenij s pomosh?ju sistemy SKAZKA (Analysis of Relate Terms with the Help of SKAZKA Program) // Problemy kompjuternoj lingvistiki: Sbornik nauchnykh trudov, 1. ...

Еще в разделе: (Показать все результаты (>4) - lcl.srcc.msu.ru/ )

... Объединенное заседание Московского математического общества и семинара имени Петровского, 18 апреля 2007 г. 18 апреля 2007, в среду, в 18:00, в аудитории 16 10 состоится объединенное заседание Московского математического общества и семинара имени И. Г. Петровского. Заседания 17 апреля не будет. ... Московское Математическое Общество . ...

Еще в разделе: (Показать все результаты (>24) - www.mmonline.ru/ )

• MMOnline | Форумы | Аспирантура | PhD position in the University of Florida

... It is shown that their chemical activity , crystal structure and other properties dramatically depend on fluorine atomic structure and on characteristics of chemical bonds in fluorides. ... 1886 F2 CaF2 ( ) . ... F (NaHF2 , KHF2 , NH4HF2 ґ ), (, HF H2O - 36° ), ( HF), : - HF + aq H+Їaq + F -Їaq + HF2 Їaq (HF)nF -Їaq, n = 2ґ4 , - KF + HF K+ + HF2 , - SbF5 + HF H2F+ + SbF6 , 3HF - HF2 + H2F+ ( ) .. ... CaF2 . ... 1986. ... BeF2 (), Al2O3 + Na3AlF6 (), () ZrF4 (HfF4) () K2ZrF6 (K2HfF6) (), K2TaF4 (). ...

Еще в разделе: (Показать все результаты (>2) - www.inorg.chem.msu.ru/ )

... NADH/NAD+ interaction with NADH: ubiquinone oxidoreductase (complex I). ... 2008 Jul-Aug;1777(7-8):729-34. doi: 10.1016/j.bbabio.2008.04.014. Epub 2008 Apr 18. ... The quantitative data on the binding affinity of NADH, NAD(+), and their analogues for complex I as emerged from the steady-state kinetics data and from more direct studies under equilibrium conditions are summarized and discussed. ...

Еще в разделе: (Показать все результаты (>14) - biochem.bio.msu.ru/ )

• [The Na+ pump and intracellular signaling mechanisms].

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... 2004 A March 2003 NATO workshop discussed mitigating the effects of space weather on technology infrastructure . Daglis I. , Baker D., Kappenman J. , Panasyuk M. , Daly E. в журнале Space Weather , издательство American Geophysical Union (United States) , том 2, ? ...

Еще в разделе: (Показать все результаты (>103) - istina.msu.ru/ )

• Kappenman J. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Climate of the Past Discussions - журнал | ИСТИНА - Интеллектуальная Система
• Faraday Discussions - журнал | ИСТИНА - Интеллектуальная Система Тематического

SITE 2010 Comprehensive Characterization of Astronomical Sites Kislovodsk, Russia, 49 October 2010 Conference Summary Marc S. Sarazin*a a European Southern Observatory, Garching, Germany Abstract The main topics discussed during the Site 2010 conference are outlined and the outcome is described. Keywords: Astronomical Site testing, precipitable water vapor, atmospheric turbulence, cloudiness, seeing 1. ... Site surveys for National observatory projects in China, India, and Iran benefit from this. ...

Еще в разделе: (Показать все результаты (>5) - site2010.sai.msu.ru/ )

... Mathematical Theory of Feedback Control . ... Annotation: this course is about mathematical equations of atmospheric diffusion which allow modeling of the problems of environment. ... The course reflects the experience and the point of view of a research group in the field of mathematical modeling of Western, Soviet and later Russian economics. ... Such approach captures the behavior of rather complex systems. ... Scientific Seminar: Mathematical Modeling of Complex Systems . ...

Еще в разделе: (Показать все результаты (>7) - hcs.cmc.msu.ru/ )

• The core courses for the specialty "Applied Mathematics and Computer Science".

... 1988; Hogeveg, Hesper, 1990; DeAngelis, Gross, 1992; DeAngelis et a., 1994; Balzter et al., ... 1,), (.1). (.1). (, 1988). 119 1. 12000 10000 12000 10000 8000 6000 4000 2000 0 8000 6000 4000 2000 0 1 11 21 31 41 51 61 71 81 91 1 1 1 21 31 4 1 51 6 1 71 81 9 1 1 01 12000 10000 12000 10000 8000 6000 4000 2000 8000 6000 4000 2000 0 1 11 21 31 41 51 61 71 81 91 0 1 11 21 31 41 51 61 71 81 91 . ... 12000 10000 12000 10000 12000 10000 8000 6000 4000 2000 0 1 11 2 1 3 1 4 1 5 1 6 1 71 81 91 im . ... 1988. ...

Еще в разделе: (Показать все результаты (>57) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc150572/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc15640/doc.pdf
• http://www.mce.biophys.msu.ru/archive/doc15641/doc.pdf

V.A. Morozov . Regularization Methods for Ill-Posed Problems . ... This monograph presents the theory and methods of approximate solutions of basic classes of ill-posed problems. It develops an abstract approach that is characterized by the following: widespread use of methods of functional analysis; concentration on general necessory and sufficient conditions of solvability and unique solvability of corresponding problems. The basic methods discussed is the methods of psendosolutions. ...

Еще в разделе: (Показать все результаты (>28) - srcc.msu.ru/ )

• Alexey N. Romanov, Zukhra T. Fattakhova, Denis M. Zhigunov, Vladimir N.
• A.Romanov, Z.Fattakhova, D.Zhigunov, V.Korchak, V.Sulimov // On the origin of
• Alexander V. Tikhonravov and Michael K. Trubetskov, "Modern design tools and a

... We need a new education quality, which will inevitably lead us towards wider possibilities of self-fulfilling of our citizens - in the first place, the young generation. ... The key factors to form the new quality of the higher education are, first - science and economy integration, universities must be "generators of ideas", and second - adjusting of education programs in order to prepare highly qualified specialists, essential for society. ... RF Education and Science Minister A.A. Fursenko ...

Еще в разделе: (Показать все результаты (>14) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/243.doc
• http://www.rsr-online.ru/doc/norm/111.doc