Еще в разделе: (Показать все результаты (>3) - mguteam.chat.ru/ )

... Поиск по МГУ | Лента новостей | ... О проекте . ... Please, enter the code that you see below in the input field. This is for blocking bots that try to post this form automatically. If the code is hard to read, then just try to guess it right. If you enter the wrong code, a new image is created and you get another chance to enter it right. ... 2003 2011 MsuNews.Ru Новости МГУ . 2003 2011 Разработка и дизайн MMForce.Net . ... Экспорт новостей (RSS) ...

Еще в разделе: (Показать все результаты (>8) - www.msunews.ru/ )

• MsuNews.Ru | Новости МГУ
• MsuNews.Ru | Блог проекта
• MsuNews.Ru | Энциклопедия

... Previous message: [RU-NGI] kernel tuning for RAID disks . Next message: [RU-NGI] kernel tuning for RAID disks . ... дисковых систем у нас не очень большая, при одновременном считывании разных файликов и открыл для себя настройки: / sys / block / sda /device/ queue _depth / sys / block / sda / queue /nr_requests / sys / block / sda / queue /rq_affinity / sys / block / sda / queue /scheduler Для серверов до сих пор лучше всего работает deadline / sys / block / sda / ...

Еще в разделе: (Показать все результаты (>435) - theory.sinp.msu.ru/ )

• wiki:syntax [THEP]
• LanHEP
• Lagrangian expressions

This page is devoted to information on Supernova 1999gi in NGC 3184 . ... Information on the original web pages for many of these images can be found on the Supernova links web page. ... NGC 3184 is a fairly close Mag 10.3 galaxy, only about half as distant as the Virgo cluster. ... Seiichi Yoshida has a 1999gi page . Odd Trondal's 1999gi page . ... CfA image . ... 14.5 . ... Jean Marie Llapasset image . ... vsnet-alert 3805 ] SN 1999gi in NGC 3184 . vsnet-chat 2438 ] Host galaxy of SN1999gi . ...

Еще в разделе: (Показать все результаты (>22) - www.rochesterastronomy.org/ )

• Bright Supernovae pages - Updates 1998
• Supernova 1999gp in UGC 1993
• Supernova 1998bu in M96

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/inf_syst_rus_2002.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/mol_biol_mosk_2006.pdf

... Version history . ... Fortran-DVM and C-DVM languages supported data distribution by equal blocks and corresponding distribution of parallel loop iterations (data parallelism). ... A new toolkit - DVM-program performance analyzer was included in the version. ... Fortran-DVM and C-DVM languages support now data distribution by non-equal blocks and parallel executed program section specification (task parallelism). ... The version 3.30 (27.12.2000) is differ from version 3.15 in the following: . ...

Еще в разделе: (Показать все результаты (>123) - sp.cs.msu.ru/ )

• Fortran DVM language description. Part 1 (1-4)
• C-DVM language description. Part 1 (1 - 4)
• Prefictor of DVM-program performance. Detailed design

UNDERSTANDING SPOKEN DISCOURSE: THE CONTRIBUTION OF THREE INFORMATION CHANNELS 1 Andrej A. Kibrik (Institute of Linguistics, Russian Academy of Sciences, kibrik@comtv.ru) Ekaterina M. хl'bert (CJSC GLITNIR Securities, ekaterina_elbert@inbox.ru) Modern linguistics generally presumes that linguistic form is a sequence of phonological segments. ... We thus tentatively split all elements that can possibly convey information in discourse into three channels: visual, prosodic, and verbal (=segmental). ...

Еще в разделе: (Показать все результаты (>120) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/mscl/2008/abstracts/dekany.pdf
• http://www.philol.msu.ru/~otipl/new/mscl/2008/abstracts/kimmelman.pdf
• http://www.philol.msu.ru/~otipl/SpeechGroup/publications/engl_99.doc

... 4, 1997 LETTERS TO THE EDITOR HETEROCYCLES WITH A BRIDGE NITROGEN ATOM. ... NOVEL SYNTHESIS OF THE OXAZOLO[3,2-a]PYRIDINIUM CATION BY RECYCLIZATION OF A MESOIONIC PRECURSOR: CONFIRMATION OF A COMPUTER PREDICTION E. V. Babaev and I. A. Oriova Mesoionic heterocycles as a rule are unstable. ... Thus on boiling in water, 2-oxo-3-acyloxazolo[3,2-a]pyridines are c6nverted to N-(~-oxoalkyl)-2-pyridones. ... We found that when water is added to a solution of 2-oxo-3-benzoyloxazolo[3,2-a]pyridine (I) in cone...

Еще в разделе: (Показать все результаты (>88) - www.chem.msu.ru/ )

... Colocation Firm US Signal Offers Virtual Private Cloud Hosting . According to the press release, adding a managed data center makes the company one of the first service providers in the Midwest to enable customers to build virtual private cloud environments.US Signal says its managed data center is built with dedicated resource pools to host virtual private servers accessible through US Signal Wide Area Networks.new managed data ...

Еще в разделе: (Показать все результаты (>31) - elana.sinp.msu.ru/ )

• editor | С Днем Победы!
• cheap moncler uk Exercises for 12 | С Днем Победы!

... NetCDF User's Guide for C . This appendix specifies the netCDF file format version 1. ... NC_VARIABLE nelems [var .. ... 4344 4601 0000 0000 0000 0000 0000 0000 C D F 001 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 17220 17921 00000 00000 00000 00000 00000 00000 [magic number ] [ 0 records ] [ 0 dimensions (ABSENT) ] 0000 0000 0000 0000 0000 0000 0000 0000 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 00000 00000 00000 00000 00000 00000 00000 00000 [ 0 global atts (ABSENT) ] [ 0 variables (ABSENT) ] . ...

Еще в разделе: (Показать все результаты (>43) - angel.cs.msu.su/ )

• : Interface MultiArrayInfo
• : Class RandomAccessFile
• Index

Meriones meridianus . Geographical pattern and historical demography of Midday gerbil Meriones meridianus (Gerbillidae, Rodentia) inferred from the sequences of the mitochondrial DNA control region . ... In order to examine DNA sequence variation, the cause of geographic patterns and historical demography of populations, we sampled 69 individuals of Midday gerbil Meriones meridianus . ... Sequences and gene organization of mouse mitochondrial DNA // Cell. ... Mitochondrial DNA in Human Pathology. ...

Еще в разделе: (Показать все результаты (>444) - zmmu.msu.ru/ )

• DNA polymorphism within Sorex araneus from European Russia as inferred from
• Contribution to the species composition and taxonomic status of some Rattus
• Genetic and cytogenetic variation of African root-rats Tachyoryctes splendens

As of 1.3, the Apache source directories have been re-organised. This re-organisation is designed to simplify the directory structure, make it easier to add additional modules, and to give module authors a way of specifying compile time options or distribute binary modules. ... The non-module source files have moved from src into src/main . ... Configure . ... For example, say it is called mod_demo.c. The archive for this module should consist of two files, in a suitable directory name. ...

Еще в разделе: (Показать все результаты (>65) - neptun.sai.msu.ru/ )

• Configuration Files
• Apache module mod_asis
• Name-based Virtual Hosts

. This is the default web page for this server. The web server software is running but no content has been added, yet.

58. NPIDB: Home

59. Родионова Жанна Федоровна

60. Irina Glushneva