О лаборатории . ... Лаборатория теоретической биофизики . ... This small program named TRAX is capable of solving systems of ordinary differential equations and plotting the solution on a phase plane as well as function of time. ... 1 комментарий " Phase plane explorer " . ... OPLS-AA patch for different types of molecules . ... All-atom automatic OPLS-AA topology generator . ... OPLS-AA? in All-atom automatic OPLS-AA topology? ... 2012 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>15) - erg.biophys.msu.ru/ )

• education ERG Research Group: Лаборатория теоретической биофизики

ChangeLog for / # # Generated by Trac 0.12.5 # 04/11/16 21:41:40 Mon, 06 Dec 2010 13:02:35 GMT is_rusinov [51:f411a1e0a5cb] * Interface.py ( modified ) corections in mouse handlers Mon, 06 Dec 2010 11:20:54 GMT darkhan [50:9cbbff6dbbaf] * Interface.py ( modified ) draw_step - draw_cell(self, cells), tag cell for self.cells Mon, 06 Dec 2010 09:36:59 GMT darkhan [49:94406d1874a2] * Automata.py ( ...

Еще в разделе: (Показать все результаты (>521) - kodomo.cmm.msu.su/ )

• http://kodomo.cmm.msu.su/trac/cca/log/?format=changelog&rev=9cbbff6dbbaf63366fa2d18fca64a8898e06b15e&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/cca/log/?format=changelog&rev=be7479f995a85f1cad490364cde42145cad9d42a&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/cca/log/?format=changelog&rev=6630f82e467576b9b440510235cd65c0e3499481&limit=100&mode=stop_on_copy

... Описание вакансии: . The Famous FMCG Company (Top-3) looks for Standards Office Manager in R Department . ... Create and register R and Regulatory documentation . ... Manage update of documentation in valid forms. Daily tracking of documentation validity and make changes in proper time to ensure the correct and on time activity of commercial production. ... Fluent English and excellent computer skills, skills to work with the databases . High skills to work with people; teamwork skills . ...

Еще в разделе: (Показать все результаты (>29) - www.chemport.ru/ )

... Study of ionic liquids by the method of voltammetry at the interface between two immiscible electrolytes . ... Polarization of the interface between ionic liquid and water was studied; the dependence of the polarization range ("potential window") on the ionic liquid solubility in water was shown. ... Key words: ionic liquids, polarization of the interface between two immiscible electrolytes, polarization, solubility in water. Moscow University Chemistry Bulletin . 2012, Vol. ... 4, P. 253 . ...

Еще в разделе: (Показать все результаты (>1203) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 52, No. 5, P. 390 (2011)
• Moscow University Chemistry Bulletin Vol. 49, No. 5, P. 313 (2008)
• Moscow University Chemistry Bulletin Vol. 51, No. 6, P. 462 (2010)

... OK ======================================= To compile CompHEP input make command ======================================= make # command output : ****************************************************************** * CompHEP -4.4p3 has been successfully built * * * * Please create a user working directory using the command * * make setup WDIR=path_to_your_user_work_dir * * NOTE: Do not use '~' to refer to home ... CompHEP-interfaces-1.0.1 has been installed successfully!! ...

Еще в разделе: (Показать все результаты (>4) - lhe.sinp.msu.ru/ )

• Atlas

As it was already mentioned, the idea behind File Juggler is rather simple: using CGI scripts as processing tools and WWW browser as user interface, display the structure and content of typical anonymous FTP server in a convenient, easily navigated form. ... My P5-133 spends about 0.025 ms on one file when doing linear search with simple criterion (690 ms for 27,000 files, search for substring among file names/descriptions with 70 hits). ... Let's now look whether we can handle 1,000,000 files. ...

Еще в разделе: (Показать все результаты (>1599) - crydee.sai.msu.ru/ )

• Keyword arguments and default arguments
• User interface
• Bugs found so far in XFree86/OS2 3.3.5

... The department was founded in late sixties by Prof. D.Ya.Martynov, who for many years was also the director of Sternberg Astronomical Institute. At present time, the head of the department is Prof. A.M.Cherepashchuk, a pupil of D.Ya.Martynov and his successor as the director of SAI. Since Prof. Martynov, the scientific activity of the department was primarily related to binary stars. ... The department consists of 15 members most of which have Ph.D. in Astrophysics. ...

Еще в разделе: (Показать все результаты (>4) - uranus.sai.msu.ru/ )

... Выпускники . Выпускники ВМиК . ... Женский клуб . ... Издательство МГУ . ... Обсуждение статей и публикаций . Новости для выпускников . МГУ им.Ломоносова . ... База данных выпускников . ... Выпускники МГУ . ... Дайв-Клуб МГУ . ...

Еще в разделе: (Показать все результаты (>33738) - www.moscowuniversityclub.ru/ )

... For those who is interested in thermodynamic modeling . Yuri Shvarov . This page is aimed mainly at the users of the software package HCh for thermodynamic (equilibrium) modeling of (geo)chemical systems and processes. However, some files presented here may also be of some interest to those who do not use HCh. ... HCh for DOS . ... User's guide for the Unitherm program intended for maintaining thermodynamic databases and calculation of thermodynamic properties of substances . ...

Еще в разделе: (Показать все результаты (>18) - www.geol.msu.ru/ )

... They in fact form surfaces that can be treated as interfaces between polar aqueous solutions and non-polar environment of phospholipidic side chains. ... That's why our idea was to study the behaviour of amino acid residues, as monomer units of proteins, in an interfacial system. Objective By means of molecular dynamics simulations we intended to study the properties of amino acid residues in a system containing liquid-liquid interface between water and hexane, which we took as a non-polar phase. ...

Еще в разделе: (Показать все результаты (>103) - polly.phys.msu.ru/ )

• Polymer Macromolecules at Surfaces, Polymer Interfaces (theory + computer
• Polymer and Soft Matter Theory Lab - Official Website
• PSMTLab - Polymers on surface

... Measurement of the MASS detectors parameters with mass program January 24, 2015 [112707] . MASS/DIMM electronics. ... Turbina-core(D): Dimm User Guide. ... N.Shatsky, V.Kornilov, The revision of the MASS/DIMM star catalogue. ... О.Возякова, В.Корнилов, Н.Шатский, Новое программное обеспечение прибора MASS/DIMM. ... V.Kornilov, N.Shatsky, S.Potanin, O.Voziakova, B.Safonov Preliminary results of astroclimate parameters measurements at the Sternberg 2.5m telescope installation site. ...

Еще в разделе: (Показать все результаты (>24) - curl.sai.msu.ru/ )

... Development of a Nonlinear Boundary Condition Approach as a New Model for the Nonlinear Acoustic   Interface Problem . ... A new theoretical approach to dealing with acoustic interface nonlinearities is presented. This approach allows one to write down a set of   nonlinear boundary conditions for the interface,   which then allows solutions to be developed within   the conventional framework of continuum mechanics. ...

Еще в разделе: (Показать все результаты (>36) - acs366.phys.msu.su/ )

• Schedule : Nonlinearity of Media and Structures, Nonlinear Testing
• Abstract (Invited)
• AUTHOR : O'Neill B

Wireshark · · · · · (Win, Mac, Linux) Open Source (http://www.wireshark.org) · · · ( ) · 2 1 · # usermod ­a ­G wireshark user · wireshark root user@host:~$telnet ya.ru 80 Trying 213.180.193.3.. ... MAC 2. MAC IP ARP 3. L4 Interface # 1 2 3 4 Domain # 1 1 Eth Address 00:00:00:00:00:0a 00:00:00:00:00:09 IPv4 Address 10.0.1.2 10.0.1.1 10.0.2.2 10.0.0.3 Flow # 1 2 Src Itf # 1:49153 3:49153 Dst Itf # 4:234 1:432 Protocol TCP UDP Edges 1-2 1-2 .. ...

Еще в разделе: (Показать все результаты (>5) - lvk.cs.msu.su/ )

LangueDOC . ... Кибрик А.Е. (ред.) Малые языки и традиции: существование на грани. ... Кибрик А.Е., Архипов А.В., Даниэль М.А., Кодзасов С.В., Майерс Том, Нахимовский А.Д. Технологии обработки языковых данных в документировании малых языков. ... Архипов А.В., Даниэль М.А., Кибрик А.Е., Нахимовский А.Д. Современные стандарты документирования малых языков. ... Кибрик А.Е. Проблема документирования 'малых' языков: теория и практика // Труды Отделения историко-филологических наук РАН. ... Paris, 2006. ...

Еще в разделе: (Показать все результаты (>93) - www.philol.msu.ru/ )

• LangueDOC :: Tools :: How-To's

... 18-ого ноября, в 16-20 в аудитории 415 ГЗ МГУ (Геологический факультет, 4-ый этаж) состоится лекция заведующего лабораторией Computational Solid State Chemistry университета г. Бат (Великобритания) одного из ведущих мировых специалистов теоретического моделирования кристаллических структур минералов, их дефектов и поверхностных свойств профессора Стива Паркера на тему "Atomistic Simulation of Oxide and Mineral Surfaces and Interfaces: Computerised Crystal Gazing" . ...

Еще в разделе: (Показать все результаты (>84) - geo.web.ru/ )

• Физико-химическое моделирование поведения тяжелых металлов (Cu, Zn, Cd) в

... Opening of the educational programme - School of CEOs, "Capsule of security" for the key managers of Bashneft Group. 2013/04/02 - 4:30pm . ... Higher School of Management and Innovation (Faculty of Lomonosov MSU) was founded in June 2006 by the Academic Council on the initiative of the Moscow State University Rector, academician V.A. Sadovnichiy and Chairman of the Board of Directors of JSFC "Sistema" V.P. Yevtushenko. ... MSU website . ... 2006-2016 MSU Higher School of Management and Innovation. ...

Еще в разделе: (Показать все результаты (>2) - hsmi.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Re: Web-interface для ICQ без проблем с кодировками. [ re: penartur2 ] . ... Re: Web-interface для ICQ без проблем с кодировками. [ re: M_K ] . ...

Еще в разделе: (Показать все результаты (>659) - www.snto-msu.net/ )

• lorien и z80 - Public forum of MSU united student networks
• Re: Новинки программного обеспечения - Public forum of MSU united student
• [CHTO] Проблемы с аплоадом из ФДС - Public forum of MSU united student networks

... Development kit for school workshop at the high school in physics and ecology, which allows to learn the basics of electronics and measure quantitative characteristics of the noise. The noise meter provides a special modular design for assembly and disassembly. In addition, every noise meter kit has a documentation containing all information about device, its characteristics, assembly instructions, lessons recommendations and electronic basics.љ 1) Display module.љ ... 4) Amplifier board.љ ...

Еще в разделе: (Показать все результаты (>13) - engineering.phys.msu.ru/ )

• Introduction to Linux

Geant4 toolkit for simulation of HEP experiments V.Ivanchenko From name of Geant4 collaboration BINP, Novosibirsk, Russia & CERN, Geneve, Switzerland Outline Geant4 history Design and tools Geant4 physics June 2002 release Prospects for future June,24 ACAT-2002 V.Ivanchenko Geant4 2 History 90th: About 100 FORTRAN MC programs in the world. The most popular in HEP GEANT3. ...

Еще в разделе: (Показать все результаты (>32) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/pose/talk.doc
• http://acat02.sinp.msu.ru/presentations/kryukov/acat02-020625.pdf
• http://acat02.sinp.msu.ru/presentations/shawhan/shawhan_plenary.pdf