DVM-system download . If you agree with licence requirements ( <copyright> ), you can download following versions of DVM-system : . ... User documentation ( html-rus , html-eng , doc-rus , doc-eng ) . System documentation ( html-rus , html-eng , doc-rus , doc-eng ) . DVM-system in source files . DVM-system for Windows95/NT as executable files . ... DVM-systen for Windows95/NT as executable files . ... To install DVM-system in Windows95/NT <MPICHWIN> library can be used. ...

Еще в разделе: (Показать все результаты (>47) - sp.cs.msu.ru/ )

. Parent Directory . Armenian1.pdf . CLS.pdf . ENEMY.pdf . Hieroglyphs.pdf . MUGH11.pdf . NUGAE.pdf . NUGAE2.pdf . SGHSUTRA.pdf . Sogd-ZY.pdf . Telibinu.pdf . Utu-as.pdf . clusters.pdf . labyrinth.pdf . luwian.pdf . lydian.pdf . palaic1.pdf . refl-ucla.pdf . sippanti.pdf . upe.pdf . wciec-paper.pdf

Еще в разделе: (Показать все результаты (>3) - imk.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>14) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

... Study . ... SPDC Laboratory . ... Катамадзе К. Г. Управление частотно-угловым спектром бифотонного поля (2013). Download: 2013-7-k_g_katamadzje.pdf (8.1 MB) . Страупе С. С. Корреляционные свойства квантовых состояний высокой размерности на основе бифотонных полей (2011). ... Управление спектром пространственных мод бифотонного поля (2014). ... Управление частотно-угловым спектром бифотонного поля (2014). ... Патерова А. В. Управление спектром бифотонного поля за счет угловой дисперсии (2013). ...

Еще в разделе: (Показать все результаты (>62) - qi.phys.msu.ru/ )

• Publications :: Quantum Information Laboratory

. Home . Structure of Data . Description . Catalog . Publications . VO . ЮБ 2000 . 11:14:20.2 . ЮД 2000 . -57:33:04 . l . 290.172 . b . 2.895 . diameter . 14.0' . (m - M) 0 . 11.4 0.05 . distance . 1900 50 pc . E(B - V) . 0.08 0.01 . log(t) . 9.65 0.05 . (J, J-H) isochrone VOTable . 2MASS data VOTable . Developed by the Team . Send us your questions or feedback

Еще в разделе: (Показать все результаты (>215) - ocl.sai.msu.ru/ )

• SAI OCL Catalog Berkeley 97
• SAI OCL Catalog Czernik 23
• SAI OCL Catalog Berkeley 72

... Тем не менее, некоторые файлы, имеющиеся здесь, могут представить интерес и для тех, кто не является пользователем HCh. Все программы имеют англоязычный интерфейс. ... HCh для DOS . ... Руководство пользователя программы Unitherm, предназначенной для ведения базы данных и расчета термодинамических свойств веществ . ... Руководство пользователя программы Main, предназначенной для подготовки файлов исходных данных для термодинамического моделирования и обработки результатов расчетов . ...

Еще в разделе: (Показать все результаты (>6) - www.geol.msu.ru/ )

• Software for resistivity and induced polarization

... A procedure for calibrating fits images from Ondrejov Multichannel Flare Spectrograph. Download CALIB.PRO . Download HALPHA.TAB . ... A procedure for extracting profiles from FITS files. ... Version of the program calibration: 12.3 for windows + SSW ( SolarSoft is a set of integrated software libraries, data bases, and system utilities which provide a common programming and data analysis environment for Solar Physics.) ... Download ASTROLIB.ZIP Here you can download library for fits files. ...

Еще в разделе: (Показать все результаты (>34) - lnfm1.sai.msu.ru/ )

• SOFTWARE HSFA 2
• Marat Abubekerov - My scientific publications

... File Attachments . ... Moving Attachment Files . ... Linking to Attached Files . ... Each topic can have files attached to it. ... The uploaded file will show up in the File Attachment table . ... It is not possible to delete attached files with the current TWiki implementation. ... Once a file is attached it can be referenced in the topic. ... Attach file: Sample.txt . ... Attached HTML files and text files can be inlined in a topic. ... Create a link to the attached file at the end of the topic. ...

Еще в разделе: (Показать все результаты (>30700) - dualopt1.cmm.msu.ru/ )

• FileAttachment - TWiki - TWiki - (printable)
• %TOPICTITLE% (17 vs. 18) - TWiki

... ZOO is a flexible and powerful content application builder to manage your content. ... ZOO moves from simply being a CCK to an Application Builder. Apps are extensions for ZOO which are optimized for different purposes and types of content catalogs. ... A flexible and powerful content application builder to manage your content. Download ZOO . ... escort beylikduzu bayan escort escort bayan escort escort istanbul escort bayan porno film escort istanbul escort beylikduzu escort bayan ...

Еще в разделе: (Показать все результаты (>6) - physcontrol.phys.msu.ru/ )

... Peer review | ... Contemporary Sociological Theory and Methodology . Dobren'kov V.I. Methodological and epistemological problems of formation of theoretical knowledge in sociology ( review ) Download PDF . Dugin A.G. Conceptual approaches to the concept of 'civilization' ( review ) Download PDF . ... New trends in the religious consciousness and behavior of Russians ( review ) Download PDF . ... Mchedlova E.M. Sociological interpretation of religious and social ( review ) Download PDF . ...

Еще в разделе: (Показать все результаты (>12) - www.socio.msu.ru/ )

... Alphabetical Class List . ... OpenGL 3D Graphics Support . Netscape/Explorer Plugin Support . ... Troll Tech Contact Information . ... It is a product of Troll Tech . ... Qt Professional Edition is provided for commercial software development. It is provided with upgrades and technical support. ... Qt Free Edition is the Unix/X11 version of Qt available for development of free software only. It is provided free of charge under the Qt Free Edition License . ... Copyright © 1998 Troll Tech . ...

Еще в разделе: (Показать все результаты (>233) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QGroupBox Class
• Using XML-RPC with Perl
• Qt-based LiveConnect Plugins

... О UNИX . ... Authenticating against Windows-Domain using SSPI . ... Apache 2.0.xx. ... These instructions assume you've successfully set up a working moin configuration (based on HelpOnInstalling/ApacheOnWin32 ) and you're expanding to include Domain Authentication. a Domain Controller . ... Configuring Apache http.conf file . ... Domain Authentication using mod_auth_sspi.so from MoinMoin.auth.http import http from MoinMoin.auth import moin_session auth = [http, moin_session] user_autocreate = True ...

Еще в разделе: (Показать все результаты (>72) - uneex.mithril.cs.msu.su/ )

• HelpOnImages - UNИX
• HelpOnUpdating - UNИX
• HelpOnTables - UNИX

... О UNИX . ... Authenticating against Windows-Domain using SSPI . ... Apache 2.0.xx. ... These instructions assume you've successfully set up a working moin configuration (based on HelpOnInstalling/ApacheOnWin32 ) and you're expanding to include Domain Authentication. a Domain Controller . ... Configuring Apache http.conf file . ... Domain Authentication using mod_auth_sspi.so from MoinMoin.auth.http import http from MoinMoin.auth import moin_session auth = [http, moin_session] user_autocreate = True ...

Еще в разделе: (Показать все результаты (>144) - uneex.lorien.cs.msu.su/ )

• HelpOnImages - UNИX
• HelpOnUpdating - UNИX
• HelpOnTables - UNИX

... I wrote some useful macros (packages) for LaTeX2e, that expanded possibilities for working with various biological texts, mainly lists of flora, outlines of classifications, bibliographies, herbaria labels, identificational keys etc. ... Download "shipunov" bundle -- ZIP-file (~ 2.1 Mb, Also on CTAN ) . Download "xecyr" package -- ZIP-file (~ 200 kb, Also on CTAN ) . ... Download "fontogroup" package -- ZIP-file (~ 8.9 Mb) . Download "dopsym-t1" package -- ZIP-file (~ 3.5 Mb) . ...

Еще в разделе: (Показать все результаты (>43) - herba.msu.ru/ )

• Bulletin of Moscow Society of Naturalists. Biological series.
• Старинная коллекция из фондов Гербария Московского университета

1) Faculty of Soil Science, Moscow State University, Moscow 119899, Russia; . ... We assessed critical loads of acid deposition and their exceedance for soils in the Kola Peninsula using a simple balance method and mapped them within 1.0° · 0.5° longitude/latitude grid cells. ... Terrestrial ecosystems in the north-western Kola Peninsula are particularly susceptible to acid deposition damage due to relatively high soil sensitivity and heavy sulphur deposition. back . ...

Еще в разделе: (Показать все результаты (>27) - eco.soil.msu.ru/ )

• EFFECTS OF ACID DEPOSITION ON ACIDITY IN PODZOLS
• CRITICAL LOADS OF ACID DEPOSITION IN EUROPEAN RUSSIA
• SIMULATION OF ACID SNOW AND RAIN IMPACT ON FORESTS

О лаборатории . ... Лаборатория теоретической биофизики . ... On this page we collect references to our resources, documentation and resources on other sites. All these data are very helpful for everybody who wants to learn practical quantum chemistry. Firefly (PC GAMESS) main page . ... ERG group wrote some articles about visualization: . ... Нет комментариев " Quantum chemistry information page " . ... Quantum chemistry information page . ... 2015 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>17) - erg.biophys.msu.ru/ )

• Python membrane generator for MD simulations ERG Research Group: Лаборатория
• Using spherical functions (from A.Granovsky manual) ERG Research Group:
• basis sets ERG Research Group: Лаборатория теоретической биофизики

Downloaded 03 Aug 2005 to 131.215.252.196. Redistribution subject to AIP license or copyright, see http://rsi.aip.org/rsi/copyright.jsp Downloaded 03 Aug 2005 to 131.215.252.196. ... Redistribution subject to AIP license or copyright, see http://rsi.aip.org/rsi/copyright.jsp ...

Еще в разделе: (Показать все результаты (>11) - hbar.phys.msu.ru/ )

RUSSIAN version . ... Sergei V. OGURTSOV . ... In 2002-2009 worked as a research scientist in the Department of Vertebrate Zoology of the Faculty of Biology MSU. Ph.D thesis entitled 'Learning the native pond odour as one of the mechanisms of chemosensory orientation of anuran amphibians' at Faculty of Biology MSU in 2004. ... Ogurtsov S.V., 2004. Olfactory orientation in anuran amphibians // Russian Journal of Herpetology, V. 11, ?1, p. 35-40. [download pdf-file] . Ogurtsov S.V., 2005. ...

Еще в разделе: (Показать все результаты (>19) - vertebrata.bio.msu.ru/ )

• Tatyana A.Ilyina
• Anna V.Klenova

... Advance Conference Program . Advance Conference Program is available for download below: . б б б б б б б б б б б б б б б б б б  ICONO-LAT-2013-program.pdf . Conference Technical Digest . The Conference Technical Digest, which is distributed among the conference participants on CD ROM, is available for download from the link below: . б б б б б б б б б б б б б б б б б б  icono-lat-2013-technical-digest.zip . ... Advance program . ... Registration info . ... Contacts . ... Exhibit . ...

Еще в разделе: (Показать все результаты (>2) - iconolat13.phys.msu.ru/ )

... Approved Presentations . ... Parallel programming technologies . ... Conference Fee . ... About Conference . Questions and Answers . ... Here you may download Conference files (right-click the link and choose save as if the document opens in browser instead of downloading): . in Russian (PDF) . ... in Russian . in English . ... 2004 Designed by Lyceum of Informational Technologies ?1533 . ...

Еще в разделе: (Показать все результаты (>5) - www.mce.biophys.msu.ru/ )