The most up-to-date information related to atmos 3.0 are collected here due to constantly increasing interest to MASS/DIMM processing software... atmos 3.0 is still beta , so the latest version is 2.97.5 (there is also 2.98.x branch which absorbs new features) . ... M' line: . ... free seeing and its relative error . ... dimm seeing and its relative error (if dimm data are present, zeros otherwise) . ... dimm turbulence power and its relative error (if dimm data are present, zeros otherwise) . ...

Еще в разделе: (Показать все результаты (>15) - curl.sai.msu.ru/ )

... Phone: +7(495)939-55-06, fax: (495)939-31-81, -mail: potapova@genebee.msu.ru The modern educational system is aimed at the achievement of the particular goals: developing the cognitive interest in children, children's intellectual development through the sensory tasks; development of the cognitive exploratory and the productive (constructive) activity; forming of the basic mathematical notions; forming of the solid worldview, broadening the children's outlook. ...

Еще в разделе: (Показать все результаты (>42) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc173923/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc151681/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc27644/eng.pdf

... Published by the Bureau of Astronomical Communications . ... TITLE OF THE ARTICLE IN RUSSIAN . ... This text contains Instructions for our Authors; at the same time, it shows the general layout of a contribution to the Astronomicheskii Tsirkulyar as it will appear published in the electronic form or printed on paper. ... The text of your article starts here. We accept articles in all branches of astronomy. ... 1543-1548, Information for Authors), text taped and figures drawn on paper. ...

Еще в разделе: (Показать все результаты (>32) - comet.sai.msu.ru/ )

• The case statement
• Welcome to Astronomical Circular

... Полная версия этой страницы: Учебка . Студенческий форум Физфака МГУ > Физфак и учеба > Форумы групп > 310 группа 2006 года рождения . ... 2.2.2007, 11:40 . Цитата(Metalluga @ 30.1.2007, 22:55) . ... Metalluga . ... Цитата(R3av3r @ 2.2.2007, 11:40) . ... DPV . ... pustota . ... У меня вот очень милая картинка из стандартных, при этом я такой еще ни у кого с форума не встречала, чему поражена . ... Нас можно поздравить с их скорым началом. pustota . ... Золотые слова, Паш... pustota . ...

Еще в разделе: (Показать все результаты (>108) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Metal Will Never Die
• Студенческий форум Физфака МГУ > Каррент мьюзик
• Студенческий форум Физфака МГУ > Ваша песня

International Laser Center of MSU . Home . ... Education . ... 06.10.2014 . October 10, 2014 . 15:00 S.A. Akhmanov Hall, KNO . ... 20.09.2009 . 3-d International Laser Graduate School "Modern Problems of Laser Physics LGS-2009 " . Moscow Vyatichi, November 9 - 11, 2009. ... March 21, 2014 . 15:00 S.A. Akhmanov Hall, Nonlinear Optics Bld. ... Home Science and education Papers . ... Laboratory . Laboratory of solid-state lasers and coherent spectroscopy . ...

Еще в разделе: (Показать все результаты (>20) - ilc.phys.msu.ru/ )

• Публикация
• Laboratory of solid-state lasers and coherent spectroscopy

... These spectral characteristics compare with introduction (ВВЕДЕНИЕ) At last time many workers have studied thermal Rayleigh-Benard convection using numerical At last time many workers have studied thermal Rayleigh- Benard convection using numerical time many At last time many workers have studied thermal Rayleigh-Benard convection using numerical used spectral methods with periodic boundary conditions. ... In numerical simulations were derived secondary stationary, [pic] where ? ...

Еще в разделе: (Показать все результаты (>8) - hit-conf.imec.msu.ru/ )

... P ast C S et. e C P aste = {e C : e e} н , e, e1 e2 P aste1 e2 : P aste1 P aste2 , . P ast [2] . ... S etC . ... Loc P ast [2] . ... 13): (мLo c)e = {w W : e , (мLo c = ) (e C w W P aste w = ). 3.2. мLo c . ... Glob (4) [Loc ] : Glob , [Loc ]e (w) = df [F ] (30) (31) {(e e) M orC (§, e) : e w}. e, , , e , , w. e w, (31) e н , P aste w = , (31) () н . ... e e0 {(e e) M orC (§, e) : Lo ce Lo ce0 = }. 8 (33) (32) Loc Lo ce0 , Lo ce0 : [Lo ce0 ]e = Lo ce0 e. , e0 e, (33) e. , (33) , P aste e0 . ...

Еще в разделе: (Показать все результаты (>153) - chronos.msu.ru/ )

• Ильичев Л. В. (Il'ichov L. V.)

... SDPfox - the software package for the prediction of functional specificity groups and amino acid residues that determine the specificity using MPA. ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ...

Еще в разделе: (Показать все результаты (>17) - bioinf.fbb.msu.ru/ )

• RNA Alignment
• SDPpred
• Alignment example

This document covers stopping and restarting Apache on Unix and Cygwin only. ... Then the parent itself exits. ... It re-reads its configuration files, and re-opens any log files. ... Note: If your configuration file has errors in it when you issue a restart then your parent will not restart, it will exit with an error. ... The USR1 signal causes the parent process to advise the children to exit after their current request (or to exit immediately if they're not serving anything). ...

Еще в разделе: (Показать все результаты (>40) - neptun.sai.msu.ru/ )

• Apache Performance Notes
• Server-Wide Configuration
• Compiling Apache under UnixWare

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

ICASS VI Programme Session 06.02: World history of the last century reflected in life stories of autochthonous minorities in the North 23.08.2008 Chair: Kazakevich, Olga; Lomonosov Moscow State University; Russia Co-Chair: Burkova, Svetlana; Institute of Philology, Russian Academy of Sciences, Siberian branch; Russia 1. ... Koshkareva, Natalya; Institute of Philology, Russian Academy of Sciences, Siberian Branch; Russia 3. Changes in Russia in 1920-50s through Forest Nenets Life Stories . ...

Еще в разделе: (Показать все результаты (>13) - lcl.srcc.msu.ru/ )

• ЛАБОРАТОРИЯ АВТОМАТИЗИРОВАННЫХ

Title Author Key words TV as a factor of children's exposure to domestic violence Lebedeva V.A. violence, children's exposure to domestic violence, physical violence, psychological violence The article elucidates the problem of children's exposure to domestic violence and the influence of television to its formation in modern Russia. ...

Еще в разделе: (Показать все результаты (>18) - www.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/eng/archive/2015/1/08.pdf
• http://www.socio.msu.ru/vestnik/eng/archive/2015/1/05.pdf

RIDGE AND TREE FEATURE DETECTION ON IMAGES A. Levashov 2, D. Yurin3 2, 3 1 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia 2 alexeylevashov89@gmail.com , 3yurin@cs.msu.ru In this article a new ridge detector with improved non-maxima suppression procedure in scale-space is proposed. ... The algorithm is tested on synthetic, landscape and medical images. ...

Еще в разделе: (Показать все результаты (>4) - imaging.cs.msu.ru/ )

... Conference Venue . ... Kirk Hatfield University of Florida, Department of Civil and Coastal Engineering, Gainesville, USA . ... Irina V. Perminova Co-Chair of Organizing Committee, Department of Chemistry, Lomonosov MSU, coordinator of the CIS IHSS chapter . ... Olga Yakimenko Conference Secretary, Department of Soil Science, Lomonosov MSU . ...

Еще в разделе: (Показать все результаты (>62) - mgumus.chem.msu.ru/ )

... Your girlfriend is ... than George's. much more beautifuler . ... Much of London ... by fire in the seventeenth century. destroyed . ... John prefers .... travelling by air to travelling on train . ... English, this year he .. ... Yesterday I bought a ... shirt. white new cotton . ... The professor said that .... the students can turn over their reports on Monday . the reports on Monday could be received from the students by him . the students could hand in their reports on Monday . ...

Еще в разделе: (Показать все результаты (>2) - anazarenko.ffl.msu.ru/ )

... Issues of the year 2010 . ... Instructions for Authors . ... The scientific English language journal ‘GEOGRAPHY, ENVIRONMENT, SUSTAINABILITY’ aims at informing and covering the results of research and global achievements in the sphere of geography, environmental conservation and sustainable development in the changing world. ... In the text the surname of the author and the year of publication of the reference should be given in square brackets, i.e. [Author1, Author2, 2008]. ...

Еще в разделе: (Показать все результаты (>55) - www.geogr.msu.ru/ )

• bkfpx

... Ph.D. in Astrophysics 1998 ("Population synthesis of X-ray sources after the burst of starformation and evolution of isolated neutron stars") Moscow State University, Moscow Russia. ... We worked on four projects (population synthesis of isolated neutron stars, log N - log S distribution of isolated neutron stars, ultra-strong elelctric fields and vacuum breakdown, close-by young compact objects). ... Magnetorotational evolution of isolated neutron stars. ... Moscow, Russia Sep 1993-until present 4....

Еще в разделе: (Показать все результаты (>93) - xray.sai.msu.ru/ )

• AXAF-Chandra

... A history of creation and development of scientific direction "Immobilized Enzymes" in Russia and the international conference "Biocatalysis. ... Also reflects the stages of creation and development of national and then international scientific conference "Biocatalysis. ... Moscow University Chemistry Bulletin . 2014, Vol. ... Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ...

Еще в разделе: (Показать все результаты (>108) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 55, No. 6, P. 315 (2014)
• Nikolai M. Emanuel
• Gleb B. Sergeev, Kenneth J. Klabunde. Nanochemistry. 2nd edition

Спокойной ночи тем, кто в тревоге, И тем, кто вернулся из дальней дороги. ... Спокойной ночи! Все хорошо, It's all right. Good night, children! Спокойной ночи, спокойной ночи! Спокойной ночи по ней идущим, Услышьте в громе небесном оркестр поющий, И путь - короче. ... Спокойной ночи маленьким детям, Пусть рано утром увидят чистое небо на свете, И путь - короче. ... Спокойной ночи, дети! ... Спокойной ночи, Bye-bye.. Good night, Спокойной ночи.. ...

Еще в разделе: (Показать все результаты (>108) - geo.web.ru/ )

• Informal geological society

... Conditons of democratization of youth work . ... The initiative for this cooperation came from the Omsk Region Administration which had been thinking about possibilities to let young people take part at the changes of the society and to let them take part at the development of democracy in the Russian Federation. ... Last not least, the process of democratization of youth work needs trust in all actors, including children and youth, that they will find their own ways to realize democracy. ...

Еще в разделе: (Показать все результаты (>44) - www.prof.msu.ru/ )

• Deadline for the next round of Project Smile applications
• PROBLEM OF POVERTY IN TAJIKISTAN AND INTERNATIONAL ASSISTANCE
• THE ROLE OF YOUTH NGOS