. Research Directions . Fundamental Problems of Automated Systems, Methodology, Technology and Security of Large-Scale Information Systems . Parallel Computing and Programming Tools . Mathematical Modelling, Computational and Applied Mathematics and Fundamental Applications . Modern Computational Technologies fof Teaching .

Еще в разделе: (Показать все результаты (>34) - srcc.msu.ru/ )

• Cluster analysis for pattern recognition in solar butterfly diagrams, AN, {\bf

... The Laboratory of Programming Technologies was established in 2001. The Laboratory's team consists of collaborators and graduate students of Computer System Automation Department that work under supervision of Professor Igor Mashechkin. ... series of works for research and development of multi-functional cross-programming system. ... Presently the main scientific direction of the Laboratory is research and development of algorithms and methods for creating data mining software. ...

Еще в разделе: (Показать все результаты (>122) - en.cs.msu.ru/ )

• Laboratory of Programming Technologies | CMC MSU
• Laboratory of Mathematical Methods of Image Processing | CMC MSU
• Laboratory of Mathematical Methods of Image Processing

ВМиК-Online! ... Поиск . ... лекция старшего вице-президента Microsoft . ... Future Directions in Computer Science . ... 2001 2012 ВМиК Online! ... Поиск по сайту . ... Комментарии и предложения присылайте на адрес info@cmc online.ru . ...

Еще в разделе: (Показать все результаты (>3) - www.cmc-online.ru/ )

... from designing patterns to sewing to wearing . ... cheap the north face . ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate key Win 7 ultimate product key windows 7 key sale win 7 ultimate product Key Windows 7 key ultimate win 7 ultimate ...

Еще в разделе: (Показать все результаты (>22) - elana.sinp.msu.ru/ )

• ralph lauren s | С Днем Победы!

... На компьютере прежде стоял Microsoft Outlook/Outlook Express. ... Если же вы случайно пропустили его появление - просто воспользуйтесь пунктом из меню *Инструменты* главного окна *Mozilla Thunderbird*: <img width="676" alt="Import Option" src="https://wiki.cs.msu.su/pub/Main/ImportingMailAccounts/import.jpg" style="float: left; border: 1px solid black;" title="import.jpg" height="255" /> ---++ ---++ ---++ ---++ ---++ ---++ ---++ ---++ ---++ ---++ Mozilla Thunderbird будет стоять на новом компьютере....

Еще в разделе: (Показать все результаты (>1709) - wiki.cs.msu.ru/ )

• (r2) ImportingMailAccounts < Main < Foswiki
• (r4) ImportingMailAccounts < Main < Foswiki
• (r1) ImportingMailAccounts < Main < Foswiki

... Форумы > Разное > Тема . ... Форумы Список тем Новая тема . ... Нужна помощь по Ассемблеру . ... mov dword [hConsole],eax . ... movzx ax,byte [var1] . mov esi,buf1+8 . ... movzx ax,byte [var2] . ... movzx ax,byte [var3] . ... invoke WriteConsoleA,dword [hConsole],buf1,30,buf1,0 . ... mov esi,buf+08h . ... buf1 db 'data A= ',' ',' ',' ',' ',' C= ',' ',' ',' ',' ',' D= ',' ',' ',' ',' ' . ... mov byte [esi+3],ah . ... Сайт работает с 29.08.2000, Copyright 2000 2011 MMOnline.Ru and MMForce.Net, . ...

Еще в разделе: (Показать все результаты (>14) - www.mmonline.ru/ )

Alternating direction implicit numerical method for 3D fluid flow simulation using GPU" . Berezin S.B., Paskonov V.M., Sakharnykh N.A. An efficient GPU implementation of the alternating direction implicit (ADI) numerical method in 3D domains is proposed. ... Keywords: alternating direction implicit method, parallel computing, GPU, Navier-Stokes equations . PostScript (in Russian) (892KB) . PDF (in Russian) (205KB) . PostScript. zip (in Russian) (394KB) . ...

Еще в разделе: (Показать все результаты (>40) - num-meth.srcc.msu.ru/ )

• "Mathematical simulation of creep processes in metal patterns made of materials

... Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures is very young. We have grown up in the laboratory of laser spectroscopy of water media. ... Use of such powerful modern tools of solution of inverse problems and problems of optimization provides successful solution of a wide range of applied problems of diagnostics and analysis of water media. ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>23) - rswater.phys.msu.ru/ )

... 2) ReplaceAll[F,{x->expr1,y->expr2.. ... V. Solve[{eqn1,eqn2,...}, {var1,var2,...}] ­ - - eqn1,eqn2,... var1,var2,... eqn leftside = = rightside. ... F1[var1],F2[var2],...}{var1,var2,...}] ­ - - eqn1,eqn2,.. ... Eliminate[{eqn1,eqn2,...}, {var1,var2,...}] - var1,var2,... eqn1,eqn2,.. ... 1) : : ) Put[expr1,expr2,expr3,... "file.ext"] ( expr>>"filename"); ­ , file.ext expr1,expr2.. ... Module[{var1, var2,...},expr1; expr2;.... ;exprn] ­ expr1; expr2;..., var1, var2,... , .. expr1; expr2;.... ;exprn; ...

Еще в разделе: (Показать все результаты (>30) - qilab.phys.msu.ru/ )

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>9) - observ.pereplet.ru/ )

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... Video tracking and behavior segmentation of laboratory rodents. Pattern Recognition and Image Analysis . ...

Еще в разделе: (Показать все результаты (>108) - graphics.cs.msu.ru/ )

• High-Quality Algorithm for Bayer Pattern Interpolation | Graphics and Media Lab
• High-Quality Algorithm for Bayer Pattern Interpolation | Лаборатория

Запись фильма . Запись фильма в программе WinView/32 . Версия 2.2.1.10 . 1998, Princeton Instruments Inc . ... верхнее положение - синхронизирован с камерой . среднее положение - закрыт . нижнее положение - открыт . Настройки программы для записи фильма . Experimental Setup . ... Number of images (число кадров фильма) ? ... CCD readout use region of interest . Accumulation 1 . ... overwrite/append append to . 3) ROI setup . ... end, end x/4 . ...

Еще в разделе: (Показать все результаты (>27) - cellmotility.genebee.msu.ru/ )

Cosmic Microwave Map Swirls Indicate Inflation . ... Yesterday, results were released showing an expected signal of unexpected strength, bolstering a prediction of inflation that specific patterns of polarization should exist in cosmic microwave background radiation -- light emitted 13.8 billion years ago as the universe first became transparent . ... BICEP2 is the building-mounted dish pictured above on the left. ... NASA Web Site Statements, Warnings, and Disclaimers . NASA Official: Jay Norris. ...

Еще в разделе: (Показать все результаты (>3118) - www.astronet.ru/ )

• Cosmic Microwave Map Swirls Indicate Inflation
• Airplane Flight Patterns over the USA
• Астронет > Airplane Flight Patterns over the USA

... Screening pattern or alignment against protein databank . ... Protein databanks . SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Pattern Alignment . ... Pattern (or alignment) . Pattern example 1: . ... Alignment example: . FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...

Еще в разделе: (Показать все результаты (>88) - www.genebee.msu.ru/ )

• Screening of pattern or alignment against PROTEIN databank

... Economic and Social Geography of Russia . ... The Natural Risk Assessment Laboratory . ... World Data Center for Geography . ... Russia s natural, economic and socio-demographic global potential . ... Supply and consumption of fresh water . Total supply and consumption of fresh water . Supply and consumption of fresh water per capita . ... Water pollution . ... Water consumption per capita. ... Sustainability of development of the environment in Russia . ... Development of Russia s industry . ...

Еще в разделе: (Показать все результаты (>27) - eng.geogr.msu.ru/ )

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Programs . ... dbmmanage is used to create and update the DBM format files used to store usernames and password for basic authentication of HTTP users via mod_auth_dbm . Resources available from the Apache HTTP server can be restricted to just the users listed in the files created by dbmmanage . ... One can usually use the file program supplied with most Unix systems to see what format a DBM file is in. ...

Еще в разделе: (Показать все результаты (>104) - itpm.msu.su/ )

• dbmmanage - DBM Ч?НФРЧ ЛчПыРкРЮС? ЦФРЯРЛ А?И?ЧбДй - Apache HTTP Server
• Changes between HTML 3.2 and HTML 4.0
• MySQL Reference Manual for version 3.23.10-alpha. - 12 MySQL Utilites

... Subject : J Abel Comments on papers . From : Jennifer Abel < jabel@rodaleinst.org > . ... I have read with great interest many of the papers posted on the Privatization conference. ... Reed and Nikolsky on agrarian reform failures and suggestions intriguing. ... The relatively "modest" decline of the past 5 years can be attributed to the fact that agriculture had good resources around 1991 including proper equipment and land in good condition. By 1995 agriculture had exhausted these resources. ...

Еще в разделе: (Показать все результаты (>51) - www.fadr.msu.ru/ )

• AGRICULTURAL AND RURAL DEVELOPMENT POLICIES
• NEW FARM RESOLUTION (From RUSAG conference)
• THE ALBANIAN AGRICULTURAL SECTOR IN TRANSITION

... We consider now change-points in different components of the frequency spectrum of typical EEG signal. ... Only few change-points in power are found in the initial EEG (unless a prominent alpha rhythm is present). ... Change-points in different frequency components of the EEG . ... Change-points in different types of the EEG alpha activity without substantial gradual changes . ... As can be seen from Fig. 7.3, the program reliably detected the change-points despite of such variety of signal patterns...

Еще в разделе: (Показать все результаты (>47) - brain.bio.msu.ru/ )

... When we are talking about the North-South system, we should notice the difference between the problems of the North-South and Western systems. The North-South system is separate from the Western system because it deals with "lower incomes and resources bases of the developing countries" (Joan Spero 149). ... The North-South issue was discussed by the three different philosophical schools, which argued whether this gap could be reduced in the modern economic system. ...

Еще в разделе: (Показать все результаты (>30) - www.prof.msu.ru/ )

• Redesign of Amtrican Educational Materials and its Time Pattern Discrimination

... Географии мирового хозяйства . ... Выберите кафедру . ... Кафедры . ... РЖ "Geography, Environment, Sustainability" . ... Учебно-методический отдел . ... Кафедра географии мирового хозяйства . Кафедра геохимии ландшафтов и географии почв . ... Diversity of hydrochemical parameters of surface waters was revealed relative to the catenary organization of elementary water catchments in the middle taiga subzone. ... Levels of the international movement of capital: geographical interpretation . ...

Еще в разделе: (Показать все результаты (>96) - www.geogr.msu.ru/ )