Запись фильма . Запись фильма в программе WinView/32 . Версия 2.2.1.10 . 1998, Princeton Instruments Inc . ... верхнее положение - синхронизирован с камерой . среднее положение - закрыт . нижнее положение - открыт . Настройки программы для записи фильма . Experimental Setup . ... Number of images (число кадров фильма) ? ... CCD readout use region of interest . Accumulation 1 . ... overwrite/append append to . 3) ROI setup . ... end, end x/4 . ...

Еще в разделе: (Показать все результаты (>27) - cellmotility.genebee.msu.ru/ )

... Screening pattern or alignment against protein databank . ... Protein databanks . SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Pattern Alignment . ... Pattern (or alignment) . Pattern example 1: . ... Alignment example: . FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...

Еще в разделе: (Показать все результаты (>68) - www.genebee.msu.ru/ )

• Screening of pattern or alignment against PROTEIN databank

... Economic and Social Geography of Russia . ... The Natural Risk Assessment Laboratory . ... World Data Center for Geography . ... Russia s natural, economic and socio-demographic global potential . ... Supply and consumption of fresh water . Total supply and consumption of fresh water . Supply and consumption of fresh water per capita . ... Water pollution . ... Water consumption per capita. ... Sustainability of development of the environment in Russia . ... Development of Russia s industry . ...

Еще в разделе: (Показать все результаты (>27) - eng.geogr.msu.ru/ )

... Airplane Flight Patterns over the USA . ... Millions of people move about planet Earth by airplane every day. Hundreds of thousands of airplane flights take place over the US every day. ... The movie depicts flight patterns that occurred over a few days in 2005 March. ... Inspection of the movie shows that some times of the day are busier than others, indicating that flights leave some destinations at times that are convenient for travelers. ... NASA Official: Jay Norris. ...

Еще в разделе: (Показать все результаты (>570) - www.astronet.ru/ )

• Airplane Flight Patterns over the USA
• Cancri 55 e: Climate Patterns on a Lava World
• Астронет > Cancri 55 e: Climate Patterns on a Lava World

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Programs . ... dbmmanage is used to create and update the DBM format files used to store usernames and password for basic authentication of HTTP users via mod_auth_dbm . Resources available from the Apache HTTP server can be restricted to just the users listed in the files created by dbmmanage . ... One can usually use the file program supplied with most Unix systems to see what format a DBM file is in. ...

Еще в разделе: (Показать все результаты (>104) - itpm.msu.su/ )

• dbmmanage - DBM Ч?НФРЧ ЛчПыРкРЮС? ЦФРЯРЛ А?И?ЧбДй - Apache HTTP Server
• Changes between HTML 3.2 and HTML 4.0
• MySQL Reference Manual for version 3.23.10-alpha. - 12 MySQL Utilites

... Subject : J Abel Comments on papers . From : Jennifer Abel < jabel@rodaleinst.org > . ... I have read with great interest many of the papers posted on the Privatization conference. ... Reed and Nikolsky on agrarian reform failures and suggestions intriguing. ... The relatively "modest" decline of the past 5 years can be attributed to the fact that agriculture had good resources around 1991 including proper equipment and land in good condition. By 1995 agriculture had exhausted these resources. ...

Еще в разделе: (Показать все результаты (>40) - www.fadr.msu.ru/ )

• AGRICULTURAL AND RURAL DEVELOPMENT POLICIES
• NEW FARM RESOLUTION (From RUSAG conference)
• THE ALBANIAN AGRICULTURAL SECTOR IN TRANSITION

... We consider now change-points in different components of the frequency spectrum of typical EEG signal. ... Only few change-points in power are found in the initial EEG (unless a prominent alpha rhythm is present). ... Change-points in different frequency components of the EEG . ... Change-points in different types of the EEG alpha activity without substantial gradual changes . ... As can be seen from Fig. 7.3, the program reliably detected the change-points despite of such variety of signal patterns...

Еще в разделе: (Показать все результаты (>47) - brain.bio.msu.ru/ )

... When we are talking about the North-South system, we should notice the difference between the problems of the North-South and Western systems. The North-South system is separate from the Western system because it deals with "lower incomes and resources bases of the developing countries" (Joan Spero 149). ... The North-South issue was discussed by the three different philosophical schools, which argued whether this gap could be reduced in the modern economic system. ...

Еще в разделе: (Показать все результаты (>20) - www.prof.msu.ru/ )

• Redesign of Amtrican Educational Materials and its Time Pattern Discrimination

... Географии мирового хозяйства . ... Выберите кафедру . ... Кафедры . ... РЖ "Geography, Environment, Sustainability" . ... Учебно-методический отдел . ... Кафедра географии мирового хозяйства . Кафедра геохимии ландшафтов и географии почв . ... Diversity of hydrochemical parameters of surface waters was revealed relative to the catenary organization of elementary water catchments in the middle taiga subzone. ... Levels of the international movement of capital: geographical interpretation . ...

Еще в разделе: (Показать все результаты (>60) - www.geogr.msu.ru/ )

Laboratory of Ferroelectricity . Directions of reseach . ... Reseach . Members . ... The main direction of the scientific reseach is : . The investigation of the influence of size effects and impurities on physical propertes and phase transitions in ferroelectrics. In the framework of this direction members of the laboratory provide the investigation of phase transitions in ferroelectrics, the investigation of dielectric, thermal properties of ferroelectric crystals. ... Main Page . ...

Еще в разделе: (Показать все результаты (>13) - ferro.phys.msu.ru/ )

• Department of General Physics and magneto-ordered matter. Physics Faculty of

... 2) ReplaceAll[F,{x->expr1,y->expr2.. ... V. Solve[{eqn1,eqn2,...}, {var1,var2,...}] ­ - - eqn1,eqn2,... var1,var2,... eqn leftside = = rightside. ... F1[var1],F2[var2],...}{var1,var2,...}] ­ - - eqn1,eqn2,.. ... Eliminate[{eqn1,eqn2,...}, {var1,var2,...}] - var1,var2,... eqn1,eqn2,.. ... 1) : : ) Put[expr1,expr2,expr3,... "file.ext"] ( expr>>"filename"); ­ , file.ext expr1,expr2.. ... Module[{var1, var2,...},expr1; expr2;.... ;exprn] ­ expr1; expr2;..., var1, var2,... , .. expr1; expr2;.... ;exprn; ...

Еще в разделе: (Показать все результаты (>7) - qilab.phys.msu.ru/ )

Mathematical simulation of creep processes in metal patterns made of materials with different extension compression properties" . Korobeynikov S.N., Oleinikov A.I., Gorev B.V., Bormotin K.S. An algorithm for numerical solving the problems of creep in metal patterns made of materials with different extension and compression properties has been developed. ... The problems of twisting during the creep of metal plates under constant concentrated forces applied at the corner points have been solved. ...

Еще в разделе: (Показать все результаты (>19) - num-meth.srcc.msu.ru/ )

• "A small-mode approximation in the stellar dynamo problem"
• "Complexity of geometric optimization by rasterization of Minkowski sums"

... A Combined Iterative Transform Method for Wave Propagation in Random Media . ... A method is presented to combine Fourier transform and finite elements for layers with randomly varying shear modulus. Fourier transform is applied to the horizontal direction. ... The assumption of a stochastic process of the shear modulus in the horizontal direction is new. ... The functional dependency on the transform coordinate leads to a loss of orthogonality of the Fourier transform. ...

Еще в разделе: (Показать все результаты (>42) - acs366.phys.msu.su/ )

• Abstract (Invited)

. Cluster analysis for pattern recognition in solar butterfly diagrams, AN, {\bf 332}, N 6, 590 - 596, 2011 (E.Illarionov, D.Sokoloff, R.Arlt, A.Khlystova). Предложен и реализован на компьютере алгоритм выделения Ветвей баттерфляй-диаграмм. Ключевые слова: Цикл солнечной активности

Еще в разделе: (Показать все результаты (>15) - srcc.msu.ru/ )

... As an example of such graphic software environments it is possible to name software «Alice» (http://www.alice.org/), which created by «Stage3 Research Group» (Carnegie Mellon University) and allows designing the virtual 3-D worlds, interactive games, animated stories without special programmer abilities. ... In «Alice» it is possible to create various 3Dprojecs, with ready or imported, for example from «3D Studio», models, using animation, sound-effects and object's transformation. ...

Еще в разделе: (Показать все результаты (>20) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc15791/doc.pdf

Les "pays" contre l'иtat Que les mouvements nationaux et ethniques traversent les luttes sociales et les affrontements des sociИtИs du Tiers Monde n'Иtonne pas ; ces sociИtИs ne sontelles pas dИchirИes par la formation de nouveaux иtats nationaux? Il est plus surprenant de voir se dИvelopper des luttes qui en appellent Ю l'autonomie ou Ю l'indИpendance au coeur de l'Europe et plus encore de la France qui incarna longtemps la forme la mieux rИalisИe de l'иtat-Nation. ...

Еще в разделе: (Показать все результаты (>137) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~summer/images/stories/publ/summary_03.doc
• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/kuznetsova.pdf
• http://www.philol.msu.ru/~rlc2010/abstracts/rlc2010_abstracts_sem26.pdf

... Publications . ... Laboratory of Mathematical Methods of Image Processing . Chair of Mathematical Physics . ... Scale-space color blob and ridge detection . Publication type . ... Feature detection in color images frequently consists in image conversion from color to grayscale and then one of grayscale detectors application. ... First, the method for direct detection of blobs and ridges in color images is proposed. ... Title = {Scale-space color blob and ridge detection}, . ...

Еще в разделе: (Показать все результаты (>199) - imaging.cmc.msu.ru/ )

• Publications | Laboratory of Mathematical Methods of Image Processing
• Image resampling and superresolution | Laboratory of Mathematical Methods of
• Semeikina E.V. | Laboratory of Mathematical Methods of Image Processing

... PREV CLASS NEXT CLASS . ... Use with MultiArrayProxy to reduce the length along a particular dimension by sampling the domain according to a (repeated) pattern. ... DecimateMap ( ConcreteIndexMap prev, int position, boolean[] pattern) . ... If pattern.length is less than the source dimension length, the pattern is repeated. public DecimateMap ( ConcreteIndexMap prev, int position, boolean[] pattern) . ... prev - ConcreteIndexMap to be composed with this. position - the dimension number to clip along...

Еще в разделе: (Показать все результаты (>17) - angel.cs.msu.su/ )

... Department . ... Contacts . ... The department offices are at the 6th and 7th floor in the Lomonosov MSU 2nd educational building (Faculty of Computational Mathematics and Cybernetics): 714 (scientific secretary of the department), 615a (head of the department), 666, 717. ... CMC Faculty at Google Maps and Yandex.Maps . ... Scientific secretary of the department, Assoc. ... Deparment of the Automation for Scientific Research (ANI) . ... 2008?2016 ASR Department , CMC Faculty , Lomonosov MSU . ...

Еще в разделе: (Показать все результаты (>5) - ani.cmc.msu.ru/ )

• Contact information

... Home . ... Board of directors . About the project . ... Read more . ... Project director . ... PhD, Research Associate . Director of the scientific part of the project . ... PhD, Deputy Vice-Rector . Technical Coordinator . ... Project coordinator . ... Coordinator of "Biological information" part of the project . ... Coordinator of "Human biomaterial" part of the project . ... Coordinator of "Animals" part of the project . ... Coordinator of "Plants" part of the project . ...