... Кафедра иммунологии Биологического факультета . ... Профессор А.А.Ярилин стоял у истоков и был идейным вдохновителем создания кафедры иммунологии на биологическом факультете МГУ, на протяжении многих лет читал основной курс по молекулярной иммунологии для студентов Биофака. ... Опубликовано 27/08/2013 16/11/2013 Рубрики Uncategorized 1 комментарий к записи Ушел из жизни А.А.Ярилин . ... Опубликовано 26/04/2012 26/04/2012 Рубрики Uncategorized 2 комментария к записи Объявление для студентов 3 курса ....

Еще в разделе: (Показать все результаты (>4) - immunology.bio.msu.ru/ )

• immunolog | Кафедра иммунологии Биологического факультета | Страница 6

... Supercomputing Technologies in Science, Education and Industry Almanac Series . ... Technological Institute for Superhard and Novel Carbon Materials . ... Therefore, in solving the problems will be applied as specialized methods for the study of polyatomic structures - the method of empirical potentials Brenner . ... AREA: Condensed Matter Physics, Theoretical Physics, Physical Chemistry . ... Moscow State Uiversity . ... Research Computing Center (RCC) of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>8) - hpc.msu.ru/ )

... Международный Университет . Междисциплинарных Знаний . ... Главная . Кафедры . ... Заведующий кафедрой - Урманцев Юнир Абдуллович, доктор биологических наук, доктор философских наук, профессор, автор многих монографий, руководитель семинаров в области общей теории систем, эволюционики, симметрологии и т.д. Кафедра системологии. ... Университет состоит из кафедр. ... Заведующий кафедрой - Куликов Алексей Михайлович, автор многих работ в области теории эволюции, генетики, эволюционной генетики. ...

Еще в разделе: (Показать все результаты (>5) - www.iuik.moip.msu.ru/ )

• Международный Университет Междисциплинарных Знаний - Контакты
• Международный Университет Междисциплинарных Знаний - Кафедры
• Международный Университет Междисциплинарных Знаний - Междисциплинарий

... Multi- and Single- Bubble Sonoluminescence: Difference in Nature of Light Emission . ... Single bubble SL is a high temperature light emission from the single spherical non deformed bubble. Consequently, the first type of light emission has luminescent nature, and the second one is a thermal glow. Using the results on laser cavitation, we obtained the critical index of cavitation Kcr at that interaction between bubbles leads to absence of high temperatures at their compression. ...

Еще в разделе: (Показать все результаты (>35) - acs366.phys.msu.su/ )

• Devices and Industrial Applications of Nonlinear Acoustics
• Schedule : Devices and Industrial Applications of Nonlinear Acoustics
• Abstract

... Selecting the backup medium . Selecting the backup tool . ... Hardware is indeterministically reliable. ... This chapter explains about why, how, and when to make backups, and how to restore things from backups. ... By having several copies of the data, it does not matter as much if one is destroyed (the cost is only that of the restoration of the lost data from the backup). ... Part of doing backups well is to make sure they work; you don't want to notice that your backups didn't work. ...

Еще в разделе: (Показать все результаты (>26) - itpm.msu.su/ )

• Message Routing and Delivery
• Writing the Master Files
• Tapes

... Conference Venue . ... Conference programme (PDF) . ... Stephan Kremb, HIV Full-Replication Technology for Identification of novel HIV Inhibitors from Multiple Sources . ... Irina Perminova, On the path forward to biomedical applications of natural polyfunctional compounds - humic substances . ...

Еще в разделе: (Показать все результаты (>77) - mgumus.chem.msu.ru/ )

• MGUMUS -- Первая международная конференция по гуминовым инновационным

... The scientific and investigating activities of the laboratory are spread in three main dimensions. ... Leading Research Associate Gibalov V.I. Assistant of professor Tkachenko S.N. Senior Research Associate Samoilovich V.G., Kozlov K.V., Popovich M.P. New Effective Enamel Coating of HF-ozonizers Electrodes . ... assistant of professor Antipenko E.E. Senior Research Associate Zosimov A.V. Ozone Including Oxidation Reactions . ... NON-TRADICIONAL METHODS OF CHEMICAL AND CATALYTIC REACTIONS PERFORMANCE...

Еще в разделе: (Показать все результаты (>5) - www.kge.msu.ru/ )

Course description: . The eighteenth century has often been described as a century of women. As Enlightenment thinkers challenged traditional ideas about the nature of society and government, they also rekindled the debate about woman's place in society. Women themselves contributed to these debates, assuming a prominent public role as salon hostesses and as enthusiastic consumers and producers of print culture. ... Week 1: Women in Enlightenment Philosophy . ... Women and Science . ...

Еще в разделе: (Показать все результаты (>56) - hist.msu.ru/ )

... The project aims to obtain a number of ferrites 3d elements M II Fe 2 O 4 ( M II = Mn , Fe , Co , Ni , Cu , Zn ) with high surface area and nanometer crystallite size for selective chemical sensors. The catalytic and sensory properties of ferrite spinel structure shows dependence on the nature of the cation M II to surface chemical properties: strength and concentration of acid sites and redox ability. ... 2008-2014 Лаборатория химии и физики полупроводниковых и сенсорных материалов. ...

Еще в разделе: (Показать все результаты (>14) - www.lssm.inorg.chem.msu.ru/ )

• The Laboratory of chemistry and physics of sensor and semiconductor materials

FORMATION AND ANALYSIS OF MODELS RANDOM INHOMOGENEOUS MEDIUMS Grachev N.E., Gromov P.A., Skripka E.M., Smirnov A.S., Tsuckanov A.A., Serdobolskaya M.L., Grachev E.A. (Moscow) Many phenomena and processes in nature can be described and researched using methods of mathematical modeling of random - inhomogeneous mediums. ... N = 1000; R 0.005 0.05, 0.027; , 5. ... N = 300; R 0.005 0.05. ... 1 0.9 0.8 0.7 0.6 0.5 0.4 0.3 0.2 0.1 0 0 20 40 60 80 100 120 140 160 180 200 . ... N = 1000; R 0.005 0.05. ...

Еще в разделе: (Показать все результаты (>77) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc151432/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc153984/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc15660/doc.pdf

... Юрий (admin) Новости ubuntu , видео , математические методы , полезные советы , природа в числах , числа No Comments . eros2 в сообществе ru_ubuntu поделился интересным рецептом, позволяющим установить в Gnome видеофайл в качестве скринсейвера . ... Итак, в GNOME любой видеофайл с помощью mplayer можно использовать как скринсейвер, для этого необходимо выполнить следующие действия: Шаг 1. ... Шаг 2. Создаем .sh-файл, который запускает mplayer с нужными параметрами (командой gedit ~/myss.sh ). ...

Еще в разделе: (Показать все результаты (>6) - tukachev.flogiston.ru/ )

... Recreational Geography and International Tourism . ... Physical Geography and Landscape Science . ... Science . ... According to the fact that ecological conflicts has a global scale in international watersheds, transboundary location of Selenga river complicates the problem of scientific resolution of the conflicts between water consumers. ... International programme in Natural Resource Management and Law offers a unique combination of Natural and Environmental Sciences and Science of Law. ...

Еще в разделе: (Показать все результаты (>5) - www.eng.geogr.msu.ru/ )

• Postgraduate study
• Undergraduate study
• Administration

... Asn Pro Ser Ser Leu .. ... CYB5_CHICK CYB5_HUMAN CYB5_CHICK CYB5_HUMAN CYB5_CHICK CYB5_HUMAN 1 MVGSSEAGGEAWRGRYYRLEEVQKHNNSQSTWIIVHHRIYDITKFLDEHP .: ... HUMAN , MOUSE } vs { CAEEL , PROWI , MARPO , BRANA , VICFA } { HUMAN , MOUSE , CAEEL } vs { PROWI , MARPO , BRANA , VICFA } { HUMAN , MOUSE , CAEEL , PROWI } vs { MARPO , BRANA , VICFA } { HUMAN , MOUSE , CAEEL , PROWI , MARPO } vs { BRANA , VICFA } HUMAN + + + + MOUSE + + + + CAEEL + + + VICFA - BRANA - MARPO + ...

Еще в разделе: (Показать все результаты (>17) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/FBB/year_08/term4/trees.pdf

... New approaches to the studies of associating ionic polysaccharides in solution and at interface . Co-ordinator - Professor M.Rinaudo . The main objective of the project is to understand the structure and nature of aggregates formed in aqueous solutions of industrially important ionic polysaccharides: chitosan and hydrophobically modified (HM) chitosan. ... Five research teams (two from INTAS members and three from Russia) with complementary expertise will be involved in the project. ...

Еще в разделе: (Показать все результаты (>52) - polly.phys.msu.ru/ )

Site navigation: . ... Publications . ... SPDC Laboratory . ... This website uses Javascript for many elements such as the menus and page customization. ... Using a clever design of polarization optic, Italian researchers have successfully created four-level 'ququart' quantum states using the polarization and orbital angular momentum of single photons. ... All persons copying this information are expected to adhere to the terms and constraints invoked by each author's copyright. ...

Еще в разделе: (Показать все результаты (>46) - qi.phys.msu.ru/ )

... Putative metal-dependent hydrolase yfiT (Металзависимая гидролаза); EC=3.- ... Дата создания документа . ... Дата последнего исправления аннотации . ... 08-FEB-2011 . ... 3D-structure; Complete proteome (Полный протеом); Cytoplasm (Цитоплазма); Hydrolase (Гидролаза); Metal-binding (Металсвязывание); Nickel (Никель); Zinc (Цинк). ... SUBCELLULAR LOCATION: Cytoplasm (Potential). ... HELIX (спираль) 21 42 . ... STRAND (слой) 52 55 . ... Complete proteome; Cytoplasm; Hydrolase; Metal-binding; Zinc . ...

Еще в разделе: (Показать все результаты (>310) - kodomo.cmm.msu.ru/ )

• Romashchenko Valeriya
• Gallium
• Styracosaurus

... In recent years among methods for analysis of a genomic data, more interest is attracted to alignment-free methods for comparing samples based on work with k-mers (oligonucleotides of length k, also called l-tuples or n-grams) directly from metagenomic reads. ... 2012) A metagenome-wide association study of gut microbiota in type 2 diabetes, Nature, 7418: 55­60. ... 2010) A human gut microbial gene catalogue established by metagenomic sequencing, Nature, 7285: 59-65. ...

Еще в разделе: (Показать все результаты (>100) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/200.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/235.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/113.pdf

To the participants of the Fourth All-Russian Students' Forum My dear friends! Today the Fourth All-Russian Students' Forum is opening and it has gathered the students filled with aspiration to work for prosperity of the Motherland from different corners of other country. The students at all times were the unique cohort of our youth combining in their nature the high civicism and high intellectual potential. ...

Еще в разделе: (Показать все результаты (>13) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/349.doc
• http://www.rsr-online.ru/doc/publications/385.pdf