... Conference Venue . ... We are very glad to announce the Second Conference on Humic Innovative Technologies Natural and engineered nanoparticles in clean water and soil technologies ( HiT-2012 ) held under auspices of the CIS Chapter of IHSS. ... The conference organizers are the CIS IHSS Chapter , the Department of Chemistry of the Lomonosov Moscow State University (Russia) and NCP CBR Humus Sapiens . ...

Еще в разделе: (Показать все результаты (>141) - mgumus.chem.msu.ru/ )

... Что такое ОТиПЛ? ... Education Department of Moscow Government . Moscow Institute for Open Education (MIOE) . Institute for Education Development (IED) . ... Moscow, Russia, August 2?6, 2004 . ... Int'l Olympiad-2004 . ... Int'l Olympiad-2003 . ... Linguistic problems . ... Traditional Moscow Olympiads (in Russian) . Linguistic Olympiads at ling.narod.ru . 2002?2008 ОТиПЛ. ...

Еще в разделе: (Показать все результаты (>305) - www.philol.msu.ru/ )

• LangueDOC :: Archi :: Alphabet
• LangueDOC :: Khinalug :: Alphabet

... Новости МГУ . ... Структура МГУ . ... Выпускники . Выпускники ВМиК . ... Женский клуб . Активное долголетие . ... Новости для выпускников . ... База данных выпускников . ... Выпускники МГУ . ... Дайв-Клуб МГУ . ... Аспиранты МГУ, разработавшие сервис по созданию трехмерных аватаров, договорились о сотрудничестве с создателями Second Life. ... С его помощью "жители" виртуального мира Second Life смогут обзаводиться трехмерными аватарами, имитирующими их облик в реальной жизни. ...

Еще в разделе: (Показать все результаты (>200) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Обсуждение материала "Аспиранты МГУ создадут 3D-аватары
• Клуб выпускников МГУ: CRISIS IN THEORETICAL PHYSICS: THE PROBLEM OF SCIENTIFIC

MAKING THE PROFILES . First of all you are expected to load a FITS file ("FILE"-"LOAD"). ... By pressing the middle button you copy the profile from the first profile window to the second one. ... An example: first integral can correspond to the profile of active region and second integral can correspond to the profile of quiet chromospheric region. ... The second profile (which is subtracted from the first one) you extract after clicking on "SUBTRACT"-"MARK QUIET PROFILE" and marking the region. ...

Еще в разделе: (Показать все результаты (>290) - lnfm1.sai.msu.ru/ )

• Data bases of Natural Satellites. Documentation. Sources

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . Тема обращения: . ... Войти в систему . ... Arakcheeva A., Chapuis G. , Petricek C. , Morozov V. в журнале Acta Crystallographica Section B: Structural Science , издательство Blackwell Publishing Inc. ... Создать обращение в службу поддержки пользователей . ...

Еще в разделе: (Показать все результаты (>1766) - istina.msu.ru/ )

• Advances in second messenger and phosphoprotein research - журнал | ИСТИНА -
• Journal of Second Language Writing - журнал | ИСТИНА - Интеллектуальная Система
• Second Language Research - журнал | ИСТИНА - Интеллектуальная Система

Some Explicit Formulas for Calculation of Conditional Mathematical Expectations of Random Variables and their Applications / Kambarbaeva G.S. // Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>90) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 6/2011

Diploma thesis abstract of student Garmatina A. A. Femtosecond laser microchanelling in multi-layer structure with the process control by laser-induced X-rays and second harmonic signal. ... For the targets composed of 2-4 layers of titanium or aluminum foils it was demonstrated that the amplitude of the x-ray signal can be associated with the moment of layers perforation during the perforation. ...

Еще в разделе: (Показать все результаты (>134) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2016/Tarhov_Emel'yanov_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2007/Khakhulin_Volkov_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2015/Lipatov_Magnitskiy_en.pdf

... О факультете . ... The Second White Sea Molecular Zoology Summer School . ... N.A.Pertzov White Sea Biological Station (WSBS MSU) invites undergraduate and graduate students studying zoology and ecology to participate in summer field school on Molecular Zoology, which will take place in September 5-19, 2010. ... Overview of major groups of invertebrates inhabiting the White Sea, determination of species with taxonomic keys, primer on zoological drawings. ... Биологический факультет МГУ . ...

Еще в разделе: (Показать все результаты (>7) - www.bio.msu.ru/ )

... The Second International Luria Memorial Conference will be held from September 24 th to 27 th , 2002 in Moscow. ... The International Executive Committee includes: prof . E. Homskaya ( Russia ) prof . M. Cole (USA) - Copresidents; prof . T. Ahutina ( Russia ) - chair of the International Program Committee , prof . M. Bezrukih ( Russia ), prof . A. Brushlinsky ( Russia ), prof .A. Christensen (Denmark), prof . A. Dontsov ( Russia ), prof . D. Feldstein ( Russia ), prof . J. Glozman,...

Еще в разделе: (Показать все результаты (>143) - www.psy.msu.ru/ )

• Second Announcement

. [ Войти ] . Главная -> Фильмы -> Second Sight . Пользователи . Демо . Деньги . Фильмы . Форум . Second Sight . Канада 2007 . отметить . Триллер . Драма . Фэнтэзи .

Еще в разделе: (Показать все результаты (>611) - kinfo.ru/ )

• Feast II: Sloppy Seconds - Фильмы - Kinfo.ru
• Initial D: Second Stage - Фильмы - Kinfo.ru
• Second Nature - Фильмы - Kinfo.ru

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>60) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• Anis. Page2

... Carbamide . ... Moscowљ? ... URALCHEM and Stamicarbon will develop a new technology for urea production . URALCHEM, a leading Russian producer of nitrogen fertilizers, signed a joint technology development agreement for the synthesis of urea with Stamicarbon, the world's top developer and licensor of urea processes. ... Laboratory of Chemical Thermodynamics љwasљestablished by Prof. Adam V. Rakovsky (corresponding member of USSR Academy of Sciences) first as a "halurgy laboratory" in 1930. ...

Еще в разделе: (Показать все результаты (>7) - td.chem.msu.ru/ )

Femtosecond Time-Resolved Transverse Kerr Effect Measurements in Magnetoplasmonic Crystals A. Yu. ... Application of external magnetic field to a magnetic medium causes alteration of reflected light amplitude that is so-called magneto-optical Kerr effect. ... For example, excitation of surface plasmon polaritons (SPP) in a magnetized sample by femtosecond laser pulses can lead to time moduation of magneto-optical transversal Kerr effect (TKE) intensity that differs from its steady-state value. ...

Еще в разделе: (Показать все результаты (>81) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/paper_nonlinear.pdf
• Research | Laboratory of Nanophotonics & Metamaterials

Please enter the lightcurve file name and period search parameters: . Lightcurve file: . ... Apply the Heliocentric correction and convert all dates to Terrestrial Time (TT)? ... Also, the Heliocentric correction cannot be applied to such lightcurves. ... This period search service is also available at the mirror sites: Mirror 1 , Mirror 2 , Mirror 3 , Mirror 4 . You may download the latest source code distribution and install the period search service at your own web server. ...

Еще в разделе: (Показать все результаты (>2) - scan.sai.msu.ru/ )

cAMP-induced conformational changes of Protein Kinase A I A-domain O. N. Rogacheva, V. E. Stefanov St. Petersburg State University, Universitetskaya nab. ... In the end, we presented the conformational transition of the A-domain in the form of a partly deterministic sequence of six events: 1) B 2) C1, D1, 3) E, 4) C2[D2], F, 5) G. The sequence of the items of this scheme corresponds to the process of the conformational transition in time. ...

Еще в разделе: (Показать все результаты (>191) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/198.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/109.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/123.pdf

Официальный сайт кафедры Математической теории интеллектуальных систем и . ... Сотрудники . ... Сотрудники :: Гасанов Эльяр Эльдарович :: Публикации Гасанова Э.Э. ABSTRACT . ... Say is an instantly solvable search problem if there exist algorithm , solving , such that . ... Then ISP (which is called problem of search of identical objects) is instantly solvable search problem, and . ... Then ISP (which is called -dimensional interval search problem) is instantly solvable search problem, and . ...

Еще в разделе: (Показать все результаты (>50) - www.intsys.msu.ru/ )

• Intelligent Systems :: Research :: :: Articles

... Straightforward implementation of the summation of the PT series is very inefficient on modern computer architectures because: At least one (or more) slow and typically not pipelined divide operation is required to calculate each individual term of the PT series Summation runs over large amount of data involving some combinations of transformed two-electron integrals, so that it is typically not processor cache-friendly Our goals Address both these problems: 1. ...

Еще в разделе: (Показать все результаты (>98) - classic.chem.msu.su/ )

• http://classic.chem.msu.su/gran/gamess/table_qdpt2.pdf
• PC GAMESS vs. WinGamess performance comparison
• Preliminary PC GAMESS v. 7.0 benchmarks on Intel Conroe

... 7 (495) 939-16-82 info@physics.msu.ru . ... MSU physicists in collaboration with their colleagues from Karpov Institute of Physical Chemistry and National Univerisity of Science and Technology (MISIS) studied the relationship between the local piezoelectric response and the molecular mobility in ferroelectric polymers. ... The mentioned polymers are characterized by the presence of at least two phases: amorphous (disordered) and crystalline. ... 7 495 939-16-82, . Fax: +7 495 932-88-20, . ...

Еще в разделе: (Показать все результаты (>118) - phys.msu.ru/ )

• Сотрудники физического факультета МГУ