Example of the Matrix of Size 6?6 with Different Tropical Rank and Kapranov Rank / Shitov Ya.N. // Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>113) - vestnik.math.msu.su/ )

... Linguistic expeditions . ... Logical and stylistic aspects of lexical semantics . ... Linguistic phenomena can be approached and described from various perspectives. ... The approach proposed here is distinctive in that it is based on logic and stylistics, which are usually considered marginal to the description of linguistic phenomena. ... A special focus in the present approach on parallel texts is directly connected with translation . ...

Еще в разделе: (Показать все результаты (>17) - lcl.srcc.msu.ru/ )

... As an example of such graphic software environments it is possible to name software «Alice» (http://www.alice.org/), which created by «Stage3 Research Group» (Carnegie Mellon University) and allows designing the virtual 3-D worlds, interactive games, animated stories without special programmer abilities. ... In «Alice» it is possible to create various 3Dprojecs, with ready or imported, for example from «3D Studio», models, using animation, sound-effects and object's transformation. ...

Еще в разделе: (Показать все результаты (>255) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc15764/doc.pdf
• http://www.mce.biophys.msu.ru/archive/doc177400/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc15650/doc.pdf

... Speech Recognition Engine 2.0 is a Windows-9x based computer program, allowing a User to utilize a multi-sensor setup consisting of several acoustic microphones, breath-sensor and lips movement detection sensor. ... The User can simply produce new spectral parameters dynamically calculated and saved in special cycled buffers called "channels". ... It is possible to produce special "speech detection" spectral channels using "speech detection" unary operation. ...

Еще в разделе: (Показать все результаты (>71) - www.intsys.msu.ru/ )

• Options
• Intelligent Systems :: Research :: :: Articles

... Potts-glass models of neural networks. ... FIXED POINTS OF PNN [pic] For any [pic], the only fixed points of a network constructed with the aid of two patterns [pic] and [pic] are these patterns themselves (and their negatives [pic]). [pic] Let us examine a case, when q = 2 and the vectors [pic] are without the signs [pic] (the signals are without the phase failure): [pic] As the neurons possess only one of the two values [pic] or [pic], formally this case is alike the Hopfield model. ...

Еще в разделе: (Показать все результаты (>59) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/kolbasova/acat.pdf
• http://acat02.sinp.msu.ru/presentations/nikitin/posterACAT2002.doc
• http://acat02.sinp.msu.ru/presentations/GGtut/Dev-07-DataManagement1.pdf

HERMITE FUNCTIONS EXPANSION BASED NON-LOCAL MEANS ALGORITHM FOR CT-APPLICATIONS1 N. Mamaev2, A. Lukin3, D. Yurin4, M. Glazkova5, V. Sinitsin6 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia mamaev.nikolay93@mail.ru, 3lukin@ixbt.com, 4yurin@cs.msu.ru 5,6 Federal Center of Medicine and Rehabilitation Ivan'kovskoye sh., ... Noise in CT-images is close to Gaussian [3]. ...

Еще в разделе: (Показать все результаты (>11) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/files/courses/ipintro2012/Lec_Pt2_MATLAB_Workshop_SHORT.pdf
• http://imaging.cs.msu.ru/files/courses/ipintro2012/Lec_Pt3_inpaint_my.pdf
• http://imaging.cs.msu.ru/pub/2013.PRIA.Levashov_Yurin.RidgeAndTree.en.pdf

... All circuit parameters have been presented in a symbolic form. ... To use the program you will need a CIR file (PSpise, DesignLab file) of your circuit. CIR file examples have been enclosured: bpasside.cir, test1.cir, test2.cir, test3.cir, test4.cir, laksamp.cir, bridge.cir, uA741acf.cir, quartz.cir. ... Ideal operational amplifier (nullor) * Nname n1 n2 n3 n4 * * In the ideal op amp data, (n1,n2) represent output nodes, * (n3,n4) represent input nodes (noninverting, inverting). ...

Еще в разделе: (Показать все результаты (>15) - astrometric.sai.msu.ru/ )

• Symbolic matrix processor

Databases (NSDC) of the Natural Planetary Satellites. ... In the file of explanations, source of data or bibliographic reference is indicated. ... File of data (Data) *.txt. ... Les donnИes standard de la base NSDB (Standard Data) . ... Any bibliographic reference has the following fields (please, don't mix up these reference fields hereafter called "fields" with the search fields where you will enter the data and which are hereafter denoted as "search fields" or "text fields"): . ...

Еще в разделе: (Показать все результаты (>178) - lnfm1.sai.msu.ru/ )

• Manpage of FITSHDR
• Proposing a METI Institute
• Data bases of Natural Satellites. Documentation. Structure

... NGOs: The Carriers of Globalization? ... Globalization process: transformation of territory and territoriality; . NGOs as players in the transformation of territoriality; . Networks of CABs in Eastern Europe as an example of deterritorialization of social space. Globalization is a process of reshaping social space and individual perception of the world through transforming the notion of territoriality from state-restricted to transnational space. ...

Еще в разделе: (Показать все результаты (>103) - www.prof.msu.ru/ )

• Conflict Transformation, Ngo And Networking
• Training For Effective Intercultural Communication
• HUMAN RIGHTS AND DEVELOPMENT

... Multi-threaded search engines . ... Unfortunately, most documents on search engines I saw in the Internet were either lists of hyperlinks without any comments, or discussions about how many documents are in the database of ... (here is the name of a search engine) and what method of counting of the number of documents was used. No words about the efficiency, i.e. how many documents on some subject I can find using this search engine, especially in comparison with the other ones. ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

• Database: publications on x-ray absorption spectroscopy

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... Further processing Only 3N events of «good» runs of previous analysis are selected: 3N triggered events exist in every run Better accordance with MC for rates 150kHz (see elog 548 by Colas) GC triggered events excluded AaFit: -6.5 (Vladimir's presentation explains reason) Zenith angle 20° (in order to look only at events with vertical tracks) After 2008 2009 2010 all fi year year year ltres: -- 0.83107 -- 0.77107 -- 1.04107 - No evidence of possible anisotropy either. ...

Еще в разделе: (Показать все результаты (>17) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/seminar/Kulikovskiy.pdf

... 2000 December 15 . IC443's Neutron Star . ... Explanation: Using x-ray data from the orbiting Chandra Observatory along with radio data from the Very Large Array , a team of researchers has discovered evidence for a new example of one of the most bizarre objects known to modern astrophysics -- a neutron star . ... The core collapsed when the star, located a reassuring 5,000 light-years away in the constellation Gemini , exploded long ago. How long ago? ... About APOD | ... NASA Technical Rep.: ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: 2000 February 28 - The Sombrero Galaxy from VLT
• APOD: August 17, 1999 - A Crescent Sunrise
• APOD: November 8, 1996 - A Solar Corona Ejection

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>154) - www.pereplet.ru/ )

... For those who is interested in thermodynamic modeling . Yuri Shvarov . This page is aimed mainly at the users of the software package HCh for thermodynamic (equilibrium) modeling of (geo)chemical systems and processes. However, some files presented here may also be of some interest to those who do not use HCh. ... HCh for DOS . ... User's guide for the Unitherm program intended for maintaining thermodynamic databases and calculation of thermodynamic properties of substances . ...

Еще в разделе: (Показать все результаты (>72) - www.geol.msu.ru/ )

• IPI2win - 1D interpretation of VES profile.
• Faculty of Geology >> Departments

... There is a distinction between buried soil and paleosol, even though the two overlap considerably. ... On the other hand, pre-Holocene paleosols in my area (southeastern Minnesota) don't look like buried soils, and are never recognized as such except by specialists. ... By this criterion, the pre-settlement alluvial soils of southeastern Minnesota are borderline paleosols, where they have been buried by sediments eroded from plowed fields. ...

Еще в разделе: (Показать все результаты (>147) - www.fadr.msu.ru/ )

• An International Consensus on Calcareous Paleosol Classification
• Abstracts
• STUDYING POLICY DELIVERY SYSTEMS

... find changesets by author, revision, files, or words in the commit message Glossary Ancestor Any changeset that can be reached by an unbroken chain of parent changesets from a given changeset. ... Branch (Noun) A child changeset that has been created from a parent that is not a head. ... Branch, anonymous Every time a new child changeset is created from a parent that is not a head and the name of the branch is not changed, a new anonymous branch is created. ... Parent See 'Changeset, parent'. ...

Еще в разделе: (Показать все результаты (>14136) - kodomo.fbb.msu.ru/ )

• allpy: 3a802644d798 sandbox/wx-dc.py
• allpy: 3a802644d798 test/usecase2.py
• Help: templating

Выпускники 1968 . ... Список выпускников . Этот список мы не контролируем . ... список не полный . ... Список выпускников из зарубежья . ... Web - ...

Еще в разделе: (Показать все результаты (>34) - foroff.phys.msu.ru/ )

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... MSU Graphics & Media Lab (Video Group) . Algorithm performs detection and tracking of foreground objects. Each frame of video sequence is subdivided into regions of two types: foreground and background objects. ... The main obstacle for segmentation here is the abundance of highly textured objects and sophisticated character of motion (bus is moving behind the static fence). ... video@graphics.cs.msu.ru . ...

Еще в разделе: (Показать все результаты (>218) - graphics.cs.msu.ru/ )

• Automatic Binary Segmentation of Moving Objects in Video | Лаборатория
• GML Matting | Graphics and Media Lab
• Removal of subtitles and logo from video | Graphics and Media Lab

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>16) - observ.pereplet.ru/ )