Described below are two methods for preparing input files with basis sets and ECPs which are not currently built in. ... Put basis sets and ECPs in directories (called here def2_svp_BAS and def2_ecp_ECP but you can call them whatever you want) and copy them to the Firefly directory. ... Both methods can also be used for preparing gamess (us) files - the check runs may not terminate properly due to certain keywords, but a useable file called 'input' is normally generated. ...

Еще в разделе: (Показать все результаты (>104) - classic.chem.msu.su/ )

• Potential Energy Surfaces with PC GAMESS/Firefly
• PC GAMESS/Firefly DOCUMENTATION - P2P communication interface; dynamic load
• Firefly DOCUMENTATION - command line arguments

University Satellites and . Space Science Education . ... Anaglyph method of a visual perception of 3-D images consists of: - simultaneous presentation of the complement images of stereomate (left image of the red color, right image of the blue color); - next following visual perception of these images through the left red filter and through the right blue filter. ... A stereomate of the anaglyph images is projecting to the screen from display of digital photogrammetric equipment. ...

Еще в разделе: (Показать все результаты (>6700) - cosmos.msu.ru/ )

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Bashkov A.B. , De_Nicolao G. , Kolmanovskii V.B. , Matasov A.I. в журнале Stochastic Analysis and Applications , издательство Marcel Dekker Inc. ... Bashkov A.B. , Kolmanovskii V.B. , Mao X. , Matasov A.I. в журнале Stochastic Analysis and Applications , издательство Marcel Dekker Inc. ...

Еще в разделе: (Показать все результаты (>1338) - istina.msu.ru/ )

• Nikol'skii D.N. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• ACS applied materials & interfaces - журнал | ИСТИНА - Интеллектуальная Система
• Bashkov A.B. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>92) - vestnik.math.msu.su/ )

... High-Contrast Pulse-Echo Ultrasonic Imaging with Post-Beamforming Nonlinear Filters . ... We introduce a system-identification post-beamfroming nonlinear filter approach to pulse-echo ultrasonic imaging. ... It is shown that the system identification approach to nonlinear ultrasonic imaging is robust and can be applied to form nonlinear echo images throughout the imaging field, i.e., not confined to the ROI where the filter coefficients were computed. ...

Еще в разделе: (Показать все результаты (>175) - acs366.phys.msu.su/ )

Описание вакансии: . Company: Bekaert NV, Zwevegem, Belgium . ... Reporting to/hierarchy: Corporate Technology Manager . Function details: This person will use his/her filtration expertise for the improvement of metal fiber based filter products and processes in close collaboration with the Product Market Managers and Technology Managers of the Business Units. ... He/she will take the necessary actions for the introduction of new applications for Bekaert liquid and gas filters. ...

Еще в разделе: (Показать все результаты (>19) - www.chemport.ru/ )

Geometrical core (core) is a maximal set of alignment positions such that C atoms in these positions are disposed similarly in ALL input protein chains. ... Minimal core size (#aa's) . ... Alternative core new atoms (%) . ... Geometrical core is a maximal set of alignment positions such that C atoms in these positions are disposed similarly in ALL input protein chain. ... Each input sequences is aligned to the corresponding sequence obtained from the ATOM section of the protein chain in the PDB file. ...

Еще в разделе: (Показать все результаты (>18) - mouse.belozersky.msu.ru/ )

• NPG-explorer
• Alignment example
• Example of alignment

Wireshark · · · · · (Win, Mac, Linux) Open Source (http://www.wireshark.org) · · · ( ) · 2 1 · # usermod ­a ­G wireshark user · wireshark root user@host:~$telnet ya.ru 80 Trying 213.180.193.3.. ... MAC 2. MAC IP ARP 3. L4 Interface # 1 2 3 4 Domain # 1 1 Eth Address 00:00:00:00:00:0a 00:00:00:00:00:09 IPv4 Address 10.0.1.2 10.0.1.1 10.0.2.2 10.0.0.3 Flow # 1 2 Src Itf # 1:49153 3:49153 Dst Itf # 4:234 1:432 Protocol TCP UDP Edges 1-2 1-2 .. ...

Еще в разделе: (Показать все результаты (>6) - lvk.cs.msu.su/ )

• http://lvk.cs.msu.su/~dimawolf/ArchEVM/Lection12.pdf
• http://lvk.cs.msu.su/~bahmurov/course_realtime/papers/balashov_et_al_eucass2011_monitoring.doc

... The influence of "fibre–matrix" interface energetic characteristics on the polymer composite strength . Abstract A correlation between energy characteristics of interfaces "fibre - polymer connective" and tensile strength of polymer composite materials (PCM) was demonstrated by the example of microplastics. ... Moscow University Chemistry Bulletin . 2010, Vol. ... 6, P. 462 . Copyright (C) Chemistry Dept., ... Copyright (C) Chemisty Department of Moscow State University . ...

Еще в разделе: (Показать все результаты (>495) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 45, No. 4, P. 250 (2004)
• Moscow University Chemistry Bulletin Vol. 49, No. 6, P. 403 (2008)
• Moscow University Chemistry Bulletin Vol. 51, No. 3, P. 241 (2010)

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>900) - zmmu.msu.ru/ )

... Научные семинары . ... расписание семинаров . семинар 1 . ... Отчет о семинаре || ... This talk will focus on one of the emerging technology for solar light conversion into electricity; the dye-sensitized solar cell. ... The present lecture will give a general background to the solar energy field with a focus on dye-sensitized solar cells. ... С докладом Dye-sensitized Solar Cells Materials and Interfaces выступил профессор Lars Kloo из Королевского технологического института г. Стокгольма. ...

Еще в разделе: (Показать все результаты (>16) - nano.msu.ru/ )

• Dye-sensitized Solar Cells ? Materials and Interfaces | MSU Nanotechnology

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/febsz.pdf

Status of mTCA Slow Control development at CMS Petr Volkov Lomonosov Moscow State University Skobeltsyn Institute of Nuclear Physics, Russia 6/27/2015 P. Volkov SINP MSU 1 uTCA: Introduction MicroTCA® - open standard for fabric computer systems. MicroTCA systems are both physically small and non-expensive. ... Use PVSSII and the JCOP Framework to develop your control applications. These are the official CMS DCS developing tools. ... CMS_MTCA_HCALTR_CRATE1 CRATES.. ...

Еще в разделе: (Показать все результаты (>140) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/proceedings2015/Collider_Volkov.pdf

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Online . ... More than 40 000 students (graduate and postgraduate) and about 7 000 undergraduates study at the university, and over 5 000 specialists do the refresher course here. ... Moscow University campus is an extremely complex system, with its 1 000 000 m2 floor area in 1 000 buildings and structures, with its 8 dormitories housing over 12 000 students and 300 km of utility lines. ...

Еще в разделе: (Показать все результаты (>196) - www.msu.ru/ )

• Exploration for Mineral Deposits
• School of Television

... Detector development Status of the recent experiments: exp. error (13 eV) 13 в theor. uncertainty (1 eV) (ref.: ... Analysis step Window for plots or histograms Information windows: comments and help for user Plots and histograms ­ active selection of data Window for histograms: variable bins size Gaussian fit save histogram into file Window for plots: zoom plot select of area repeat the action Selection of signals Rise-time 0,2 MIN 0,8 MIN MIN Signal after low-pass filter Qi Qj Original ...

Еще в разделе: (Показать все результаты (>66) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/GGtut/Dev-08-Information1.pdf
• http://acat02.sinp.msu.ru/presentations/fruehwirth/talk.pdf
• http://acat02.sinp.msu.ru/presentations/litinski/litinski.doc

... Interface description . ... 6 Distributed array creating and deleting . ... 13.4 Access to elements of local part of distributed array . 13.4.1 Requesting if array element is allocated in local part of distributed array . ... 13.4.5 Coping element of local part of distributed array to element of local part of other distributed array . 13.4.6 Requesting address of element of local part of distributed array . ... 14.5 Access to distributed array elements, allocated in remote element buffer . ...

Еще в разделе: (Показать все результаты (>126) - sp.cs.msu.ru/ )

• Fabrik - A Visual Programming Environment

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/jbcb_2006.pdf

... Custom Query . ... Component . ... automata io requirements ui . ... And љ Blocked By Blocking Cc Component Created Description Keywords Milestone Modified Owner Priority Reporter Resolution Status Summary Ticket Type . Or љ Blocked By Blocking Cc Component Created Description Keywords Milestone Modified Owner Priority Reporter Resolution Status Summary Ticket Type . ... Summary Component Milestone Status Owner Type Priority Resolution Created Modified Blocked By Blocking Reporter Keywords Cc . ...

Еще в разделе: (Показать все результаты (>788) - kodomo.cmm.msu.su/ )

• Custom Query в?' Cyclyc Cell Automata

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>136) - bioinf.fbb.msu.ru/ )

• SDPlight
• SDPsite - Gallery of examples
• Alignment example