... Tombaugh 4 . ... 21.10.2006 . ... But the skilled and careful astronomer also went on to discover star clusters, comets, asteroids, and clusters of galaxies. For example, pictured is galactic or open star cluster Tombaugh 4 in the northern constellation Cassiopeia . ... Publications with keywords: open cluster - star cluster . Publications with words: open cluster - star cluster . ... M45: The Pleiades Star Cluster . ... X Ray Stars of Orion . Starburst Cluster in NGC 3603 . ...

Еще в разделе: (Показать все результаты (>3127) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"

... Automatic detection and description of supercomputer network infrastructure" . ... In order to solve this problem, Moscow University Research Computing Center is currently developing the Octotron system whose main objective is to provide the maximum safety and fullest usage of the hardware. ... In this paper we describe a programming tool being developed in order to detect Ethernet and Infiniband network topology in supercomputer systems. ...

Еще в разделе: (Показать все результаты (>300) - num-meth.srcc.msu.ru/ )

• "Application of the Quickhull algorithm's principles to the double description
• "TreeDL: a language for description of graph structures and operations on them"
• "General description of subroutines for solving ordinary differential equations

... It is shown that theoretical methods developed for description of hopping transport in disordered inorganic solids, such as amorphous semiconductors, can also be successfully applied to description of hopping transport in organic disordered systems, such as conjugated or molecularly doped polymers. We concentrate our discussion on percolation approach and show its universal applicability to systems with different distributions of localized state energies. ...

Еще в разделе: (Показать все результаты (>35) - scon155.phys.msu.su/ )

• Generalized pair approximation in the description of ate AC conductivity of a

MSU . Science Park . ... Venue & Space . ... At Moscow State University Science Park, the laboratory and administrative offices are available to hire by innovative companies on a long or short term basis. ... MSU Science Park is situated in a picturesque area of Moscow, close to the MSU Botanical Garden on Sparrow Hills. With eight, two-storey buildings of 500 m 2 each on the site plus a four-storey building with an area of 7,500 m 2 , there is a total building area of 11,500 m 2 . ...

Еще в разделе: (Показать все результаты (>6) - www.sciencepark.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... On this page we collect references to our resources, documentation and resources on other sites. All these data are very helpful for everybody who wants to learn practical quantum chemistry. Firefly (PC GAMESS) main page . ... ERG group wrote some articles about visualization: . ... Нет комментариев " Quantum chemistry information page " . ... Quantum chemistry information page . ... 2015 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>59) - erg.biophys.msu.ru/ )

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>12) - antares.sinp.msu.ru/ )

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>114) - vestnik.math.msu.su/ )

Calcareous paleosols are widely distributed throughout the arid and semi arid regions of the world. These paleosols have been described from virtually every continent of the world, yet there is no internationally agreed upon nomenclature for the description of the horizons present within them. ... This abstract proposes the adoption of a universally agreed-upon system of horizon designation and gross morphological description of calcareous paleosols. ... Soil Science, 101, 347-360. ...

Еще в разделе: (Показать все результаты (>259) - www.fadr.msu.ru/ )

• Foundation for Agrarian Development Research - Services - Portfolio
• NEW FARM RESOLUTION (From RUSAG conference)

... Basis of Differential Invariants for Several Concrete Groups and Its Applications . ... For Navier-Stokes equations, describing three-dimensional motions of viscous fluid, basis consists of one finite and 12 first-order differential invariants. ... An application of the basis of differential invariants allows one to give a group treatment of known solution of above-mentioned models as well as to obtain a new one. ...

Еще в разделе: (Показать все результаты (>85) - acs366.phys.msu.su/ )

... Parent Directory - 1-1-GeneralTopology-Conspectus-2009.pdf 26-Aug-2009 19:49 189K 1-1-GeneralTopology-Conspectus-Addendum-5-5-2009.pdf 09-Sep-2009 12:56 131K 1-4-Examples-Addendum.pdf 22-Sep-2009 11:50 89K Alexandrov-168-169.pdf 08-Sep-2009 12:36 225K ControlWorks/ 05-Sep-2009 15:50 - FAQ/ 08-Sep-2009 13:53 - Poincare.pdf 08-Nov-2007 15:29 296K Program-2009.pdf 16-Aug-2009 12:31 89K Test1-2009.pdf 28-Aug-2009 15:42 83K UchPr-2009.htm ...

Еще в разделе: (Показать все результаты (>275) - higeom.math.msu.su/ )

... 2013-03-19 02:34 . ... index.htm . ... 1.1M . ...

Еще в разделе: (Показать все результаты (>352) - herba.msu.ru/ )

• Systema Naturae
• Index of /shipunov/school/biol_154/textbook/pics
• Описание экскурсии на гору Малая Куртяжная.

... DESCRIPTION General Catalog of Variable Stars (GCVS database) . ... Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1990, General Catalogue of Variable Stars, 4rd ed., vol.IV, Nauka, Moscow. Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1992, General Catalogue of Variable Stars, 4rd ed., vol.IV, Bull. ... Kazarovets E.V., Durlevich O.V. Editor-in-Chief Samus N.N., 1998, New Catalogue of Suspected Variable Stars. ...

Еще в разделе: (Показать все результаты (>64) - sai.msu.ru/ )

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>40) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>102) - neptun.sai.msu.ru/ )

• Manual Page: ab - Apache HTTP Server
• Apache module mod_negotiation
• Manual Page: htpasswd - Apache HTTP Server

... Research programm of the laboratory-chair< . ... Laboratory-chair of Discrete mechanics on a microscopic scale . ... Thus the structures of the physical world are not physical objects but physical processes. ... The primitive entity is called a material point. ... The value of the property “existence” of the material point varies from “the material point does not exist” to “the material point exists” by this process. ... Let call this structure a dynamical graph or a d-graph. ...

Еще в разделе: (Показать все результаты (>369) - chronos.msu.ru/ )

• On the Way to Understanding the Time Phenomenon: the Constructions of Time in
• Russian Interdisciplinary Temporology Seminar

Exciplexes on INTERNET . http://www.syp.toppan.co.jp:8082/6606/N5019/KEN5019M01.html . ... last fetched: 02-Jun-95 . bytes: 24034 . ... bytes: 7133 . ... outline: Computational Chemistry Research Computer Programs: Send a message. keys: exciplex . excerpt: Don Truhlar's Home Page Computational Chemistry Research Research Program Summary: Our research group is carrying out theoretical and computational studies of chemical reaction dynamics, molecular energy transfer, and molecular modeling. ...

Еще в разделе: (Показать все результаты (>345) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 49, No. 4, P. 226 (2008)
• Moscow University Chemistry Bulletin Vol. 48, No. 4, P. 235 (2007)
• Moscow University Chemistry Bulletin Vol. 49, No. 4 (2008)

Structure of southern taiga landscape in border zone of Wurm glaciation D.N. Kozlov1, M.Yu. ... The analysis should renew them semantic complete pattern and should determine uncertainty areas of logical or formal model. ... Detection of uncertainty area in current models of structure, genesis, functioning of landscapes is the basis for task-oriented researches. ... Borders between smaller blocks locate erosion network and determine configuration of hierarchical lineament landscape structures. ...

Еще в разделе: (Показать все результаты (>2037) - www.sevin.ru/ )

• A.N. Severtsov Institute of Ecology and Evolution (IPEE RAS): Site News: Site
• Laboratories: The security center of Biosystems: Results
• Экологический Форум - Фундаментальная Экология: center China. the example, the

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ... As colored columns of the alignment. ...

Еще в разделе: (Показать все результаты (>256) - monkey.belozersky.msu.ru/ )

• Inquiry information || Parsimony algorithm
• SCOP famyli:
• SCOP famyli: T4 endonuclease V

... Микс 193 A 131 A 171 A 211 A 304 A Корона Магнитограмма . 211 + 193 + 171 . Description . ... LASCO (Large Angle and Spectrometric Coronagraph)- инструмент на космическом аппарате SOHO, поставляющий изображения солнечной короны, на которых свет, идущий непосредственно от Солнца, заблокирован с помощью искусственного затмения, создаваемого самим аппаратом. ... The form and the location of the magnetospheric boundary are defined by pressure balance of the solar wind and geomagnetic field. ...

Еще в разделе: (Показать все результаты (>1228) - swx.sinp.msu.ru/ )