Laboratories \ The security center of Biosystems \ Results . ... Results . ... Research development on the problem of "Ecotoxicology of environmental resistant organic pollutants by the example of investigation of the consequences of the chemical war of the USA in Vietnam" was generalized in the published in 2006 monograph "Dioxins and human health. ... In the process of research in Vietnam the new data of primary importance about toxic effects of dioxins on polluted by them territory were obtained: . ...

Еще в разделе: (Показать все результаты (>3807) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: effective is itself "tourist
• Экологический Форум - Фундаментальная Экология: Gucci the The example, people
• Laboratories: Group for Bioinformatics and Modeling Biological Process: Results

... The first idea ­ an arithmetic triangle. ... In work [1] has been offered descriptive geometric optic model on the basis of consideration of binomial distribution for the description of propagation of light in the laser. ... In work [3]the new algorithm of construction of a nonlinear arithmetic triangle on the basis of numerical modeling and binary notation has been offered, communication of the offered algorithm and binomial coefficients of various types is shown. ...

Еще в разделе: (Показать все результаты (>214) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc15811/doc.pdf

... Structure of Data . ... Catalog . ... The SAI OCL Catalog site provides several VO-enabled modes of operation: . VO-enabled catalog data analysis from a browser . ... Endpoint URL is http://ocl.sai.msu.ru/catalog/conesearch/ . ... VO-enabled catalog analysis from a browser . Presently, this recipe works with Firefox (Windows, MacOS, Linux), Internet Explorer (Windows) and Opera (Windows) browsers with Java plugin 1.6 installed. ... Main TOPCAT window with SAI OCL catalog loaded will appear. ...

Еще в разделе: (Показать все результаты (>222) - ocl.sai.msu.ru/ )

• SAI OCL Catalog Description

... 2015 . ... Submit your article . ... Ph.D., Faculty of Philosophy, Lomonosov Moscow State University; assistant professor, Journalism and Media Education Department, Sholokhov Moscow State Humanitarian University. ... The primary task of this article is to analyze the reaction of public authorities to acts of terrorism on the example of the government of Spain after the tragic events of March 11 th , 2004. ... 119991, Room A-710, Shuvalovskiy building, Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>130) - ee-journal.spa.msu.ru/ )

. Nhunt: program for nucleic acid sequence similarity search . Download . User manual . Application examples . License . News . About . Authors publications . Contacts . Web interface . At present you can download poster from MCCMB'11 conference and my term work (in Russian) with description of main program algorithms. Funding: Ministry of Education and Science of the Russian Federation (State Contract No. 07.514.11.4006). Copyright 2010-2011 Yury Pekov

Еще в разделе: (Показать все результаты (>21) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes

Tombaugh 4 . ... Credit Copyright: Dean Rowe Explanation: Clyde Tombaugh discovered planet Pluto in 1930 while surveying the skies with the 13-inch Lawrence Lowell Telescope. But the skilled and careful astronomer also went on to discover star clusters, comets, asteroids, and clusters of galaxies. ... Published in 1941, Tombaugh's description, based on his photographic images from the Lowell 13-inch, indicates the cluster is small and faint, and comprised of about 30 stars. ...

Еще в разделе: (Показать все результаты (>5512) - www.astronet.ru/ )

• Tombaugh 4
• Visual Effects: Wonders of the Universe
• A Triple Sunrise Over Gdansk Bay

Pentium 4 2.2 GHz . ... Pentium D 3.0 GHz, serial . Pentium D 3.0 GHz, parallel or multithreaded . ... input , output ) . ... Pentium 4 2.2 GHz , P4B (Northwood), 512 Kb L2 cache, no HTT support, 2200 MHz, 400 MHz FSB, 512 MB PC800 RamBus RIMM RDRAM, 60 GB IDE HDD, Windows 2000 Professional SP4. ... Serial - PC GAMESS is running using only one core . Parallel or multithreaded - PC GAMESS is running using only both cores in parallel (tests 1,3,5,6) or multithreaded (tests 2 and 4) modes. ...

Еще в разделе: (Показать все результаты (>98) - classic.chem.msu.su/ )

• Just kidding: PC GAMESS/Firefly v. 7.1.C benchmarks on Atom-based system
• Preliminary PC GAMESS benchmarks on Quad-core Xeon (Clovertown)-based system
• Two years later: Firefly version 8.0.0 beta benchmarks on Intel Core i7 2600K

... It is shown that theoretical methods developed for description of hopping transport in disordered inorganic solids, such as amorphous semiconductors, can also be successfully applied to description of hopping transport in organic disordered systems, such as conjugated or molecularly doped polymers. We concentrate our discussion on percolation approach and show its universal applicability to systems with different distributions of localized state energies. ...

Еще в разделе: (Показать все результаты (>108) - scon155.phys.msu.su/ )

• Generalized pair approximation in the description of ate AC conductivity of a
• Kinetics of domain structure in ferroelectric thin films
• EXAFS studies of the interaction of Ge off-center atoms and impurities in GeTe

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>17) - antares.sinp.msu.ru/ )

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>102) - vestnik.math.msu.su/ )

Calcareous paleosols are widely distributed throughout the arid and semi arid regions of the world. These paleosols have been described from virtually every continent of the world, yet there is no internationally agreed upon nomenclature for the description of the horizons present within them. ... This abstract proposes the adoption of a universally agreed-upon system of horizon designation and gross morphological description of calcareous paleosols. ... Soil Science, 101, 347-360. ...

Еще в разделе: (Показать все результаты (>272) - www.fadr.msu.ru/ )

• Foundation for Agrarian Development Research - Services - Portfolio
• NEW FARM RESOLUTION (From RUSAG conference)
• REPORT ON INTERNATIONAL SOIL SCIENCE CONGRESS (Montpellier, France, August...

GENERATION OF PARTICLES IN VACUUM IN PRESENCE OF STRONG ELECTROMAGNETIC FIELDS S. A. SMOLYA NSKY ? ... The process of particle-antiparticle pairs generation in the presence of strong electromagnetic fields is described, using the simplest models of physical vacuum. ... Further we discuss the latest works on kinetic description of the process of particles generation in vacuum in the presence of strong non-stationary fields. ­ . 2001 =c m c +p . ... 2mc2. - - , 2mc2 2 (-) (-) . ... kin , Vmax . ...

Еще в разделе: (Показать все результаты (>156) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/210809/nesterenko.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/220809/Demidov.pdf

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Chshiev M. , Manchon A. , Kalitsov A. , Ryzhanova N. , Vedyayev A. , Strelkov N. , Butler W.H. , Dieny B. в журнале Physical Review B - Condensed Matter and Materials Physics , издательство American Institute of Physics (United States) , том 92, ? ... GRANOVSKII AB, VEDYAEV AV , KALITSOV AV . ...

Еще в разделе: (Показать все результаты (>3398) - istina.msu.ru/ )

• Chshiev M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Kukkonen J. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Sofiev M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... 2013-03-19 02:34 . ... index.htm . ... 1.1M . ...

Еще в разделе: (Показать все результаты (>414) - herba.msu.ru/ )

• Systema Naturae
• The employment of quantitative methods for the lake ecosystem research
• Index of /shipunov/school/biol_154/textbook/pics

... Parent Directory - 1-1-GeneralTopology-Conspectus-2009.pdf 26-Aug-2009 19:49 189K 1-1-GeneralTopology-Conspectus-Addendum-5-5-2009.pdf 09-Sep-2009 12:56 131K 1-4-Examples-Addendum.pdf 22-Sep-2009 11:50 89K Alexandrov-168-169.pdf 08-Sep-2009 12:36 225K ControlWorks/ 05-Sep-2009 15:50 - FAQ/ 08-Sep-2009 13:53 - Poincare.pdf 08-Nov-2007 15:29 296K Program-2009.pdf 16-Aug-2009 12:31 89K Test1-2009.pdf 28-Aug-2009 15:42 83K UchPr-2009.htm ...

Еще в разделе: (Показать все результаты (>271) - higeom.math.msu.su/ )

... Stress-Dependent Complementary Variations in P- and S-Wave Velocities for Rocks Containing   High-Compliance Porosity: an Effective-Medium Model and Comparison with Experiments . ... A 3D effective-medium model describing variation in rock elastic moduli due to presence of high-compliant defects is considered. ... The ratio of the normal-to-shear compliance of the defects was determined for different rock samples. The results confirmed that, in saturated rocks, defect’s shear compliance dominates. ...

Еще в разделе: (Показать все результаты (>274) - acs366.phys.msu.su/ )

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>89) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should
• V.V.Pipin, D.D.Sokoloff The fluctuating $\alpha$-effect and Waldmeier relations

... DESCRIPTION General Catalog of Variable Stars (GCVS database) . ... Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1990, General Catalogue of Variable Stars, 4rd ed., vol.IV, Nauka, Moscow. Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1992, General Catalogue of Variable Stars, 4rd ed., vol.IV, Bull. ... Kazarovets E.V., Durlevich O.V. Editor-in-Chief Samus N.N., 1998, New Catalogue of Suspected Variable Stars. ...

Еще в разделе: (Показать все результаты (>71) - sai.msu.ru/ )

... Research programm of the laboratory-chair< . ... Laboratory-chair of Discrete mechanics on a microscopic scale . ... Thus the structures of the physical world are not physical objects but physical processes. ... The primitive entity is called a material point. ... The value of the property “existence” of the material point varies from “the material point does not exist” to “the material point exists” by this process. ... Let call this structure a dynamical graph or a d-graph. ...

Еще в разделе: (Показать все результаты (>449) - chronos.msu.ru/ )

• On the Way to Understanding the Time Phenomenon: the Constructions of Time in
• Russian Interdisciplinary Temporology Seminar
• A. P. Levich

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )