... Полная версия этой страницы: Unix Developer - Moscow . Студенческий форум Физфака МГУ > Общий > Работа . ... American offshore company PowerFile (www.powerfile.com) is looking for a Unix/Linux developer for . ... Projects mostly have to do with developing data storage systems oriented . to huge amount of data. ... knowledge in Unix/Linux systems - syscalls, Posix, RPC, Networking, NFS, Samba . knowledge in FS internals - at least VFS layer . SCSI protocol/drivers knowledge . ...

Еще в разделе: (Показать все результаты (>1557) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Software Developer
• Software Developer - Студенческий форум Физфака МГУ
• Unix Developer - Moscow - Студенческий форум Физфака МГУ

.

Еще в разделе: (Показать все результаты (>2) - lab110.imec.msu.ru/ )

Geant4 toolkit for simulation of HEP experiments V.Ivanchenko From name of Geant4 collaboration BINP, Novosibirsk, Russia & CERN, Geneve, Switzerland Outline Geant4 history Design and tools Geant4 physics June 2002 release Prospects for future June,24 ACAT-2002 V.Ivanchenko Geant4 2 History 90th: About 100 FORTRAN MC programs in the world. The most popular in HEP GEANT3. ...

Еще в разделе: (Показать все результаты (>59) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/GGtut/Dev-01-Introduction1.pdf
• http://acat02.sinp.msu.ru/presentations/GGtut/Dev-02-Basics1.pdf
• http://acat02.sinp.msu.ru/presentations/GGtut/Dev-05-Communication1.pdf

... About lab . ... The LidarK library provides an open-source framework for processing multidimensional point data such as 3D LIDAR scans. ... Download LidarK 2.0 , or browse for the previous versions and data samples . ... We called the data structure we designed Seg-Tree . ... GML LidarK Library v. 2.0 September 10, 2010 Download . GML LidarK Library v. 1.2 December 5, 2008 Download . GML LidarK Library v. 1.1 September 9,2008 Download . GML LidarK Library v. 1.0 July 1, 2008 Download . ...

Еще в разделе: (Показать все результаты (>249) - graphics.cs.msu.ru/ )

• GML LidarK Library | Лаборатория компьютерной графики и мультимедиа
• DOC3d: A 3d Documentations system for programming languages | Graphics and
• Automatic Binary Segmentation of Moving Objects in Video | Graphics and Media

Search for simple and composite auxin responsive elements in Arabidopsis thaliana genome. ... AR Fs bind in target promoters to the specific sites called AuxRE s (Auxin Response Elements) with the TGTCN N (most frequently TGTCTC) consensus core sequence. ... To test which model predicts AuxREs associated with auxin response better , we performed meta-analysis of publicly available 23 microarray experiments with auxin treatments (Mironova et al., ...

Еще в разделе: (Показать все результаты (>194) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/225.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/81.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/37.pdf

CDFE => Online Services => NSR Search Engine Description . This program lets to find articles from Nuclear Science References (NSR). I. Names and descriptions of NSR Search Engine fields . ... Quantity Type Parameter type of <SELECTRS>. ... Target nucleus Chemical symbol or charge and atomic number of target nucleus. ... Range of energy Range of reaction energy (Example: 0.3 - 1 GeV ). ... Example: 1998) . ... Work scheme NSR Search Engine. ... NSR Search Engine printscreen for example. ...

Еще в разделе: (Показать все результаты (>28) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Relational ENSDF
• CDFE => Online Services => Calculator and Graph Engine for Atomic Nuclei

MATSYM - symbolic matrix processor . ... To use the program you will need a MAT file (liked CIR file: "User manual for CIRSYM program") of your system. ... In first string of MAT file enter any text you want to be the title of your system. ... Starting from string 2 (if is not comments - "*") enter the system element name, incident row and column and, optionally, its value. ... To generate a solution, run MATSYM.exe and enter "system_file_name.CIR" or click on the "ENTER" (in "MAT" case). ...

Еще в разделе: (Показать все результаты (>12) - astrometric.sai.msu.ru/ )

... Social security is a necessary element of any developed society. Given the financial crisis the country is undergoing today, it is important to optimize the social security financial support and objectively evaluate its current condition. There are no common approaches to the formation of financial indicators of financial support of social protection. ... Social protection, social program, financial support, indicator, effectiveness, evaluation system. ... Public Administrarion". ...

Еще в разделе: (Показать все результаты (>162) - ee-journal.spa.msu.ru/ )

... CVS . ... ASM Kislovodsk . ... Anonymous CVS access through CVS protocol: . cvs -d :pserver:anonymous@curl.sai.msu.ru:/srv/cvs/cvsroot . Anonymous CVS browse through ViewVC: . ... Rs485 CVS . ... ASM Dome demon CVS . ... CVSROOT at curl.sai.msu.ru is located in /srv/cvs/cvsroot . You may access to CVS repository via SSH only using your curl's account login/password. ... export CVSROOT=curl.sai.msu.ru:/srv/cvs/cvsroot . ... CVS_RSH=ssh cvs -d user@ curl.sai.msu.ru:/srv/cvs/cvsroot command . ...

Еще в разделе: (Показать все результаты (>24) - curl.sai.msu.ru/ )

... THE CATEGORICAL VIEWPOINT Some p eople love categories, and others hate them; but they are here to stay! ... Some categories are large, such as top, the category of top ological spaces and continuous maps. Others are small (finite, even!), such as the category cat(K ) of faces of a simplicial complex K and their inclusions. ... The lo cal viewp oint considers toric spaces as diagrams, whereas the global viewp oint interprets their invariants as functors from geometric to algebraic categories. ...

Еще в разделе: (Показать все результаты (>145) - higeom.math.msu.su/ )

• Publications (English)
• Publications (Russian)
• C*-algebras: Talks

... Data . ... Models . ... Paraboloid model . ... SHIELDOSE is a model for space-shielding radiation dose calculations. ... Next the index of the detector type is specified, for example '1'. ... The next number indicates the nuclear interaction account, for example 1: . ... The next pair of numbers is about solar protons, the min and max energy of solar protons spectrum, default values are 0.1 and 10000 MeV. ... The next number is the number of spectrum points which divides spectrum for integration. ...

Еще в разделе: (Показать все результаты (>68) - smdc.sinp.msu.ru/ )

• Space monitoring data center
• IGRF10 model - Space monitoring data center

... Research . ... Linguistic expeditions . ... Up to now the subjects to documentation were local dialects of Selkup, Ket, and Evenki. ... 1) creation and enlargement of multimedia computer archives of Selkup, Ket, and Evenki speech, which include sounding dictionaries and folklore texts and life-stories in audio, video, and graphic representation in local dialects of the surveyed villages; development of linguistic multimedia databases; . ... 8) research into the Selkup-Ket-Evenki language contacts; ....

Еще в разделе: (Показать все результаты (>24) - lcl.srcc.msu.ru/ )

... The technique had been developed for calculating destruction of melting vitreous bodies in hypersonic gas flows taking into account the internal radiative transfer. ... The problem of flow in the chemically non-equilibrium boundary layer at a stagnation point of blunt body had been solved by the asymptotic method and formulas for the heat and diffusion fluxes to a surface of any catalycity had been obtained. ...

Еще в разделе: (Показать все результаты (>5) - lab106.imec.msu.ru/ )

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ґ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ґ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf

... Interaction classes . ... List of Contact Types: . ... Contact with Major Groove of DNA by helices, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by strands, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by helices, loops . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by loops . ...

Еще в разделе: (Показать все результаты (>5) - npidb.belozersky.msu.ru/ )

Chalkina N.A. Inertial Manifold for a Hyperbolic Equation with Dissipation . ... Sheipak I.A. Spectrum of a Jacobi Matrix with Exponentially Growing Matrix Elements . Sergeev I.N. Oscillation and Wandering of Solutions to a Second Order Differential Equation . Bednov B.B. Steiner Points in the Space of Continuous Functions . ... Kombarov Yu.A. The Minimal Circuits for Linear Boolean Functions . ... Kolyada S.S. Unit Checking Output Tests under Constant Faults for Functional Elements . ...

Еще в разделе: (Показать все результаты (>109) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika

Distributed systems as pattern formation models: space-time behavior investigation and elements of dynamics control". ... A new method of local dynamics analysis of coupled map lattices (CML) was proposed. ... New effects of global behavior of CML was found. Maps can represent some systems. ... And the points represent state of the system, which was determined by Rybalko method (Lambda values; color = period = order, black = zero period = chaos) and the period of cycle (P values). ...

Еще в разделе: (Показать все результаты (>60) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/loskutov/PDF/Galss_ceramics.pdf
• http://chaos.phys.msu.ru/loskutov/PDF/TMPh_quadratic_cml.PDF
• http://chaos.phys.msu.ru/prokhorov/phd/tmf_eng.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf

... 3 ґ Sternberg State Astronomical Institute, Moscow, :jeanna@sai.msu.ru The graphic method of the analysis of an arrangement of linear structural elements on geographical and geological maps of continents (A.V.Dolitsky, [1]) has allowed to find out global stress fields of the past and among them one which directions (the main normal and maximal tangents) describe more than 80 % of all linear elements of a relief. ... The found poles share program way on density of an arrangement on 3-4 groups. ...

Еще в разделе: (Показать все результаты (>74) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Shev/Publications/m44_76_sinitsin_shevchenko.pdf
• http://selena.sai.msu.ru/Ber/Publications/ms40/88_Yamashita%20et_al.pdf
• http://selena.sai.msu.ru/Symposium/peter.doc

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>17) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Alignment example
• PLANdbAffy: probe-level annotation database for Affymetrix expression