... Home > Scientific laboratories > IM . ... The Laboratory of Industrial Mathematics (LIM) headed by Professor V.M. Goloviznin was established in the Faculty of Computational Mathematics and Cybernetics (CMC) of Lomonosov Moscow State University in 2011. ... In the area of energy and space, examples of topical engineering problems LIM is involved in, include the numerical simulation of new-generation atomic plants and computational aeroacoustics. ... Source URL: http://en.cs.msu.ru/laboratories/im . ...

Еще в разделе: (Показать все результаты (>103) - en.cs.msu.ru/ )

• Laboratory of Industrial Mathematics | CMC MSU
• Laboratory of Mathematical Methods of Image Processing | CMC MSU
• Department of Mathematical Physics | CMC MSU

Mailing List . Discussion club . Unresolved problems in the Study of Nature and Evolution of Human Language . ... Our goal is to consider some interesting and still unresolved problems of general theory of Human Language. ... Regularities of Human Language Evolution”. ... Universal, typological and stylistic features of Human Language Evolution; . ... Large Explanatory Dictionary of Russian (SPb: Norint, 1998. - 1536p.): preliminary evoluation of the dictionary (Russian letter "X") . ...

Еще в разделе: (Показать все результаты (>53) - old.philol.msu.ru/ )

• Melnikov G.P.- Systemology and Linguistic Aspects of Cybernetics
• Using Markov Chains for Identification of Writers
• Khmelev D.V.- Disputed Authorship Resolution Using Relative Empirical Entropy

1) You will be picked up in the airport - please look for a person with the plate "Workshop - Theory and Computer Simulation of Polymers". ... From this metro station another (or the same person) will help you to reach your hotel. ... 9) The place of the conference has been changed to the so-called First Academic Building of MSU on New Territories (it will be marked on the map of MSU campus on the web-site). ...

Еще в разделе: (Показать все результаты (>93) - polly.phys.msu.ru/ )

• Polymer and Soft Matter Theory Lab - Official Website
• Welcome to my page

... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...

Еще в разделе: (Показать все результаты (>2) - oc.cs.msu.ru/ )

... Revision Log Mode: Stop on copy Follow copies Show only adds and deletes View log starting at and back to . ... edit) . ... 5 years . me.dendik . ... Added rule to evade trapping yourself while eating for e4 snake . ... Added "run mostly forward" rule to e2 snake . ... Changed display names in e2, e4 snakes (they were both Example тАж . ... e4 snake now tries to zig-zag . ... Added two smarter snakes: e2 and e4 . ... snakes added . ... Added example empty snake . ... Added example snake . ...

Еще в разделе: (Показать все результаты (>384) - kodomo.cmm.msu.su/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... This Python module parses Gaussian cube files, produced by quite a few QM software packages, and makes volume data available as numpy array as well as some associated properties. ... Нет комментариев " Gaussian Cube files loader " . ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>30) - erg.biophys.msu.ru/ )

• python ERG Research Group: Лаборатория теоретической биофизики
• Building and plotting Fukui function with FireFly and PyMol ERG Research Group:
• Visualize partial charges in PyMol ERG Research Group: Лаборатория

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... Unless in many other approaches to the analysis of different signal coupling, the information entering the analysis of synchronization in our approach is explicitly represented in the form of elementary, instantaneous events (the change-points). ... Hence the use of correlation/coherency estimates in parallel with change-point analysis seems to be quite rational. ...

Еще в разделе: (Показать все результаты (>51) - brain.bio.msu.ru/ )

• Change-points at different levels of the hierarchy of EEG segmental...
• Change-points in EEG components with different pattern
• Nonparametric approaches to the description of EEG piecewise stationary

CSA Call Information Call Title: Call for proposals for ERC CSA (Supporting action) Call identifier: ERC-2009-Support Date of publication: 24 July 2008 Call deadline: 12 November 2008, at 17.00.00 (Brussels local time) Indicative budget: EUR 2 500 000 1 from 2009 budget The upper limit for the Community financial contribution is 100%. ... Co-ordination and support actions (Support) are open to Associated countries. ... The minimum participation is 1 independent legal entity (CSA-Support). ...

Еще в разделе: (Показать все результаты (>34) - ideas.msu.ru/ )

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>14) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

HERMITE FUNCTIONS EXPANSION BASED NON-LOCAL MEANS ALGORITHM FOR CT-APPLICATIONS1 N. Mamaev2, A. Lukin3, D. Yurin4, M. Glazkova5, V. Sinitsin6 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia mamaev.nikolay93@mail.ru, 3lukin@ixbt.com, 4yurin@cs.msu.ru 5,6 Federal Center of Medicine and Rehabilitation Ivan'kovskoye sh., ... Noise in CT-images is close to Gaussian [3]. ...

Еще в разделе: (Показать все результаты (>8) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2013.PRIA.Levashov_Yurin.RidgeAndTree.en.pdf
• http://imaging.cs.msu.ru/files/courses/ipintro2012/Lec_Pt2_MATLAB_Workshop_SHORT.pdf

... In this case both the medium and the electric field depend on two space coordinates only. ... The classical modeling presentation is in apparent resistivity which reflects an electric field distribution on the earth's surface. ... An expression can be derived for the potential value in point M ([pic]): [pic], (4) where [pic] is the potential of the primary electric field, [pic] is the potential of the secondary electric field, defined by the surface charge distribution. ... pic] |[pic] | ...

Еще в разделе: (Показать все результаты (>60) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

Symbolic circuit-matrix processor and evaluator . ... This software is reliable over the range of benchmark circuit complexity (both *.CIR and *.MAT file). ... SYMBOL is a symbolic-algebra package which in contrast to REDUCE, MACSYMA, MAPLE, MATHEMATICA, MathLAB, MathCAD and other known multi-purpose systems is especially intended for analysis of any lumped, linear, time-invariant circuit. ... pure ASCII text . ... CIRSYM - SYMbolic CIRcuit processor used to format ASCII text file *.out for CALCSYM. ...

Еще в разделе: (Показать все результаты (>11) - astrometric.sai.msu.ru/ )

• Symbolic circuit processor

DVM-system of parallel program development . Goals and structure . ... 2.1 C-DVM and Fortran DVM parallel program development . ... Using C-DVM and Fortran-DVM languages a programmer deals with the only version of the program both for sequential and parallel execution. ... These rules are syntactically organized in such a manner that they are "transparent" for standard C and Fortran compilers and doesn't prevent DVM-program execution and debugging on workstations as usual sequential program. ...

Еще в разделе: (Показать все результаты (>96) - sp.cs.msu.ru/ )

• DVM-system. Version history
• Blue Book Chapter 26
• HPF DVM. Language specification

О лаборатории . ... На сайт добавлен пакет Lightbox 2.04 (http://www NULL .huddletogether NULL .com/projects/lightbox2/) (by Lokesh Dhakar) для отображения графики с дополнительными визуальными эффектами: . http://www NULL .huddletogether NULL .com/projects/lightbox2/images/image-1 NULL .jpg) (http://www NULL .huddletogether NULL .com/projects/lightbox2/images/image-2 NULL .jpg) . ... Tags: site lightbox . ... Лаборатория лазерной интерферометрии is proudly powered by WordPress . ...

Еще в разделе: (Показать все результаты (>11) - geo.sai.msu.ru/ )

• Hello world! Лаборатория лазерной интерферометрии
• elstream.ru: онлайн видеотрансляции с Эльбруса Лаборатория лазерной
• Northern Lights over Norway Лаборатория лазерной интерферометрии

... 2008. NONHOLONOMIC MECHANICS Gauss Principle and Realization of Constraints V. V. Kozlov* V.A. Steklov Institute of Mathematics, Russian Academy of Sciences, ul. ... From (3) it immediately follows that an actual motion is a virtual one. ... x (10) If one considers this relation as a definition of virtual motions, then the generalized Gauss principle leads to the equation x=- Е ,x x, (x, x) V x which also has the integral of energy, but differs from the initial equation (9). ...

Еще в разделе: (Показать все результаты (>121) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/7bb/RCD701.pdf
• http://ics.org.ru/upload/iblock/250/188-an-extended-hamilton-jacobi-method_ru.pdf
• http://ics.org.ru/upload/iblock/400/172-hamiltonization-of-nonholonomic-systems-in-the-neighborhood-of-invariant-manifolds_ru.pdf

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

59. http://www.innovation.msu.ru/english/methodsforfinancingfourcompany.doc

60. http://www.ffl.msu.ru/research/publications/komarova/komarova-the-earth-and-its-people.pdf