... 129 - 129I. 9 [1, 2]. 129Xe. . 1 1 © тЫНУОНУ, ы.Д., 1996 "" - , - - . ... 244Pu? ... 136Xe, 134Xe, 132Xe. ... 130Xe 20 1 2 3 10 0 124 129 126 128 130 132 134 , 136 . ... тмдйгыдйЗ ы.Д. бЗЦбСзДь ихгъ З кмдДп 75 , , 107 Ag ( 107Ag 109Ag). ... 107 Ag / 109 Ag 53 Cr / 52Cr 10 4,0 5 0 60 200 000 400 000 108 Pd / 109Ag 26 0 Mg / 24Mg 0,155 0,150 0,4 55 0,8 Mn / 52Cr Ni / 58Ni 40 20 0,145 0,140 0,135 0 200 000 400 000 56 Fe / 58Ni 0 200 27 400 Al / 24Mg . ... 129Xe, 136Xe, 107Ag, 53Cr, 60Ni, 26Mg . ...

Еще в разделе: (Показать все результаты (>156) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/200809/Stodolsky_nuta.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/190809/Dolgov.pdf

... The role of wine tax-farming system in the forming of large capitals in Russia in the 19th century, . ... The article is devoted to one of the most profitable business activities in Russia at the end of the 18th century to the beginning of the 1860s. The author researches the social and national structure of wine tax-farmers, the level of their incomes as well as the ways and methods of accumulation of capital, in particular, their ties with the aristocracy and state officials of all levels. ...

Еще в разделе: (Показать все результаты (>135) - hist.msu.ru/ )

• Shares at St.Petersburg Stock Exchange in 1900s
• Visual Images of Patriarch Nikon

The Ecological Cooperation Project is the first large-scale children's network project in Russia. This project was founded on the principles of development and achievement of widespread nature awareness among Russian school children through the establishment and unification of numerous childrenтАЩs ecological projects. ... Nature Protected Areas . ... The Project is open for cooperative learning, and any childrenтАЩs ecological organization or group is welcome to participate. ...

Еще в разделе: (Показать все результаты (>9) - www.ecocoop.ru/ )

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>339) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~alex2308/align/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta

. Yu.A.Shokin . Accurate positions of variable stars in the western part of the Large Magellanic Cloud bar . (published in IBVS and SAI Proceedings ) . B.S.Vozdvijenski, N.P.Gorbatko, V.A.Yeliseev, G.V.Romanova . The results of the observations of the selected minor planets in Sternberg State Astronomical institute . (published in SAI Proceedings ) .

Еще в разделе: (Показать все результаты (>13) - astrometric.sai.msu.ru/ )

• AMT articles
• Scientific Literature

... Here is a brief outline of the current theory of the events in the early history of the solar system: . A cloud of interstellar gas and/or dust (the "solar nebula") is disturbed and collapses under its own gravity. ... The gas cools off enough for the metal, rock and (far enough from the forming star) ice to condense out into tiny particles. (i.e. some of the gas turns back into dust). ... Once the larger of these particles get big enough to have a nontrivial gravity, their growth accelerates. ...

Еще в разделе: (Показать все результаты (>2) - www.iki.rssi.ru/ )

• Nine Planets Technical Help

Design of Micrometeoroid/Orbital Debris Impact Shield and Development of Failure Risk Assessment System for Orbital Spacecraft N.G. Chechenin Skobeltsyn Institute of Nuclear Physics Lomonosov Moscow State University Space Debris Growth http://www.nasa.gov/pdf/582393main_OCT-Orbital_ Debris _TAGGED.pdf January 19, 2015 China-Russia Joint Space Science Project Proposals Workshop 2 Space ... Crater formation January 19, 2015 Craters on metal surface from meteoroid particle. ...

Еще в разделе: (Показать все результаты (>97) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/Articles_GSIB/nimb206_861_clasterionsize_Yamada.pdf
• http://danp.sinp.msu.ru/Seminars_Pdf-filesPresentations/Chechenin_Presentation_14-01-16.pdf

XXVIII General Assembly of the IAU, SPS15 Beijing, August 31, 2012 . N.N. Samus, S.V. Antipin "Variable Stars and Data-Intensive Astronomy" . During the 26th IAU General Assembly in Prague, the IAU Division V (Commissions 27 and 42) considered the future of variable-star catalogues. ... To discuss these problems and to look for their solutions, the IAU Commission 27, on behalf of the IAU Division V, created an informal working group, chaired by the GCVS editor, Dr. Nikolai Samus. ...

Еще в разделе: (Показать все результаты (>127) - sai.msu.ru/ )

• Презентация PowerPoint
• GCVS Research Group: Recent publications

General Information . ... Scientific research . ... For physics faculty . ... Department of General Physics and Magneto-Ordered Matter is one of the largest Chairs of Physical Faculty of Lomonosov Moscow State University with long-standing traditions and a numerous community of high qualification teaching personnel and researchers, performing research in the most actual fields of condensed matter physics and teaching graduates in magnetic and ferroelectric phenomena. ...

Еще в разделе: (Показать все результаты (>33) - ferro.phys.msu.ru/ )

• Physics Department of Moscow State University

Internet Engineering Task Force M. Allman INTERNET-DRAFT ICSI File: draft-allman-tcpm-no-initwin-00.txt November 24, 2015 Intended Status: Best Current Practice Expires: May 24, 2016 Removing TCP's Initial Congestion Window Status of this Memo This document may not be modified, and derivative works of it may not be created, except to format it for publication as an RFC or to translate it into languages other than English. ... 4) The initial cwnd MUST be bounded by the receiver's advertised window. ...

Еще в разделе: (Показать все результаты (>15594) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/internet-drafts/draft-ietf-radext-bigger-packets-05.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/bcp/bcp202.txt
• http://mirror.msu.net/pub/rfc-editor/internet-drafts/draft-wood-tsvwg-saratoga-congestion-control-08.txt

SCIENTIFIC TASKS AND RESULTS . In the results of searching for new perspective solid state materials for the quantum electronics, non-linear optics and other fields of physics more than 200 various oxide compounds were synthesized and peculiarities of their atomic structure and physical properties are studied. Single crystals of 80 such the compounds are grown and thoroughly investigated. ... A family of oxide-ion conductors on the base of La 2 Mo 2 O 9 (30.10.09) . ... Main page ...

Еще в разделе: (Показать все результаты (>304) - polly.phys.msu.ru/ )

• Seminar in Polymer Physics
• Recent selected publications

... Publications . ... SPDC Laboratory . Quantum Electronics Chair . ... Error: You currently have Javascript disabled. ... 11 , 065203 (2014). ... Quantum key distribution (QKD) is a concept of secret key exchange supported by fundamentals of quantum physics. ... Download [ help ]: . Download paper: doi page . Download paper: link to publisher . ... All persons copying this information are expected to adhere to the terms and constraints invoked by each author's copyright. ...

Еще в разделе: (Показать все результаты (>118) - qi.phys.msu.ru/ )

... Home > Department of Algorithmic Languages . Head of the department: Mikhail G. Malkovskiy, Professor, Dr.Sc. ... Vladimir G. Abramov, Associate Professor, PhD, Scientific Secretary of the Department . ... Algorithms and Algorithmic Languages by Prof. Solovyev, 54 lecture hours and 72 seminar hours, 1st semester. ... Prof. Bordachenkova, 48 lecture hours and 64 seminar hours, 2nd semester. ... Prof. Volkova and Dr. Vylitok, 46 lecture hours and 60 seminar hours, 4th semester. ... Prof. Abramov. ...

Еще в разделе: (Показать все результаты (>104) - en.cs.msu.ru/ )

• Department of Algorithmic Languages | CMC MSU
• Invited lecture by Prof. Vijay Ganesh (University of Waterloo, Ontario, Canada)
• Laboratory of Difference Methods | CMC MSU

trendence Graduate Barometer Europe 2011 About the survey ґ About trendence trendence Graduate Barometer Europe is an annual online student survey which allows students to express their opinion on topics re lated to career and education. ... Ulrike Heyne Project Manager trendence Graduate Barometer Europe 2011 About the survey Facts and benefits How does it work? ... If your students take part in the trendence Graduate Barometer, they will receive an exclusive Student Report. ...

Еще в разделе: (Показать все результаты (>3) - studsov.math.msu.su/ )

Databases (NSDC) of the Natural Planetary Satellites. ... NSDC: Database of astrometric observations of Natural Planetary Satellites . ... They are thoroughly looking for observations in different sources, creating their owndatabases which are then mostly inaccessible to other researchers. ... In the file "content" with explications, the reference is given to the data source as well as the bibliographic reference. ... Data sources. ... Why a specific bibliographic database for Natural satellites? ...

Еще в разделе: (Показать все результаты (>504) - lnfm1.sai.msu.ru/ )

• Sputnik and SETI: Uniting East and West
• Proposing a METI Institute
• Data bases of Natural Satellites. Documentation. Sources

Stephanorhinus kirchbergensis . Records of Stephanorhinus kirchbergensis (Jager, 1839) (Mammalia, Rhinocerotidae) from the Obв?T River at Krasny Yar (Tomsk region, southeast of Western Siberia) . ... First records of Stephanorhinus kirchbergensis (Jager, 1839) (Mammalia, Rhinocerotidae) from the Kuznetsk Basin (Kemerovo region, Kuzbass area, South-East of Western Siberia) // Bolletino della Societa Paleontologica Italiana. ...

Еще в разделе: (Показать все результаты (>1371) - zmmu.msu.ru/ )

• Russian Journal of Theriology
• Tropical centre
• Primates of the genus Altanius (Mammalia, Primates) from the Lower Eocene of

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Online . ... More than 40 000 students (graduate and postgraduate) and about 7 000 undergraduates study at the university, and over 5 000 specialists do the refresher course here. ... Moscow University campus is an extremely complex system, with its 1 000 000 m2 floor area in 1 000 buildings and structures, with its 8 dormitories housing over 12 000 students and 300 km of utility lines. ...

Еще в разделе: (Показать все результаты (>88) - www.msu.ru/ )

• Victor T. Trofimov. Vice-Rector
• Faculty of Soil Science

... Master . ... Zel'dovich asteroid . ... August 29, 2013: Asteroid (11438) Zeldovich discovered 40 years ago . ... Asteroid (11438) has quite an elongated orbit with a period of 3.25 yr and eccentricity 0.19 (twice that of Mars). ... Asteroid will be located in Cancer constellation at the distance of 1.63 AU from Earth and 2.62 AU from the Sun (near the aphelion of its orbit), with the magnitude being 17.0m. Telescopes of MASTER network will definitely observe asteroid (11438) Zeldovich in early 2014....

Еще в разделе: (Показать все результаты (>199) - master.sai.msu.ru/ )

• SAI Space Monitoring Laboratory

... In recent years among methods for analysis of a genomic data, more interest is attracted to alignment-free methods for comparing samples based on work with k-mers (oligonucleotides of length k, also called l-tuples or n-grams) directly from metagenomic reads. ... 2012) A metagenome-wide association study of gut microbiota in type 2 diabetes, Nature, 7418: 55ґ60. ... 2010) A human gut microbial gene catalogue established by metagenomic sequencing, Nature, 7285: 59-65. ...

Еще в разделе: (Показать все результаты (>171) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/133.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/26.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/196.pdf

... Handling file uploads . ... The MAX_FILE_SIZE item cannot specify a file size greater than the file size that has been set in the upload_max_filesize ini-setting. ... If memory limit is enabled, larger memory_limit may be needed. Make sure to set memory_limit large enough. ... Make sure to set max_execution_time large enough. If post_max_size is set too small, large file cannot be uploaded. Make sure to set post_max_size large enough. ... Uploading multiple files ...

Еще в разделе: (Показать все результаты (>135) - oit.cmc.msu.ru/ )

• pg_locreate
• PostgreSQL functions
• pg_loopen