Higher-order anisotropic flows and dihadron correlations in Pb-Pb in AMPT" Jun Xu and Che Ming Ko Phys.Rev. C84 (2011) 044907, arXiv 1108.0717 .. ... Description of High harmonics and Ridge effect in AMPT. 2Part and Flow correlation 4. <uQ*> Some useful formulae, I Some useful formulae, II Some useful formulae, III Some useful formulae, IV Results, A. Anisotropic flows, centrality AMPT 1. ... B. Dihadron correlations, ||and pT Jet region Ridge region trigg 1. ... B. Dihadron correlations, || ...

Еще в разделе: (Показать все результаты (>59) - lav01.sinp.msu.ru/ )

• http://lav01.sinp.msu.ru/~vlk/UPC_2002.pdf
• http://lav01.sinp.msu.ru/~vlk/UPC_2008_orig.pdf

. [ Войти ] . Главная -> Фильмы -> Wanda at Large . Пользователи . Демо . Деньги . Фильмы . Форум . Wanda at Large . США 2003 . отметить . Сериал . Комедия .

Еще в разделе: (Показать все результаты (>633) - kinfo.ru/ )

• Livin' Large! - Фильмы - Kinfo.ru
• Dave Allen at Large - Фильмы - Kinfo.ru
• Masterchef Goes Large - Фильмы - Kinfo.ru

... Department of Vertebrate Zoology . HEAD OF THE LABORATORY . leading researcher Elena P. Kruchenkova . The main research of the Lab deals with behavioural interactions in higher Vertebrates. Though the Laboratory of Vertebrate Behaviour is rather new, it is very popular among students of the Department. ... leading researcher E.P.Kruchenkova . ... Acoustic communication of mammals and birds: factors that determine variability. senior researcher I.A.Volodin , researcher A.V.Klenova . ...

Еще в разделе: (Показать все результаты (>54) - vertebrata.bio.msu.ru/ )

• Выступления студентов и аспирантов на конференциях

... Moscow Lomonosov State University . ... Consider an open network consisting of N nodes (stations) and V(N) cars, which circulate among the stations. The network is divided into n clusters. ... Cluster j contains d N j N stations, Е j = 1 n d N j = 1. ... Later j and v denote cluster numbers and they take values from 1 to n. The arrival process to a station of cluster j is a Poisson one with the rate l j . ... The destination station in the cluster v is chosen uniformly. ...

Еще в разделе: (Показать все результаты (>40) - old.philol.msu.ru/ )

• Dmitry V. Khmelev: List of Publications

... Полная версия этой страницы: A large IT company is looking for J2EE Developer . Студенческий форум Физфака МГУ > Общий > Работа . ... Design, coding, testing, implementation and production support of enterprise-level J2EE applications; Business analysis, discovery, and technical specification development; J2EE cross-training activities; career- and goal-oriented; . ...

Еще в разделе: (Показать все результаты (>917) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > A large company is looking for Senior J2EE
• Студенческий форум Физфака МГУ > Ph.D. in Large Lakes Observatory (University
• A large company is looking for Senior J2EE Developer - Студенческий форум

Home :: Personnel :: Blagodatskikh, Inesa Vasilievna :: List of Publications . O.I. Shchegolikhina, I.V. Blagodatskikh, Yu.A. Pozdnyakova, A.A. Zhdanov . ... I.V. Blagodatskikh, A.V. Gorshkov . ... Polymer Science, Series A , 1997, vol. 39, p. 1681. ... I.V. Blagodatskikh, M.V. Sutkevich, N.L. Sitnikova, N.A. Churochkina, T.A. Pryakhina, O.E. Philippova, A.R. Khokhlov . ... J.A. Shashkina, O.E. Philippova, Yu.D. Zaroslov, A.R. Khokhlov, T.A. Priakhina, I.V. Blagodatskikh . ...

Еще в разделе: (Показать все результаты (>325) - polly.phys.msu.ru/ )

• SHORT ANNOTATION AND MAIN RESULT
• Selected publications of Vasilevskaya, Valentina Vladimirovna
• Biography

Stephen Price (Southampton U) Q: The difference of theoretical and experimental patterns is rather high, why? The difference between the experimental and theoretical patterns is large in the case of the Cu and Pd EXAFS because only the first nearest neighbour shell is fit, that only the atoms within 3 е of the absorber. In contrast, the Au EXAFS is fit up to 6 е and so the theoretical and experimental patterns is much less. ... Q: What was the technology of underpotential deposition? ...

Еще в разделе: (Показать все результаты (>17) - www.elch.chem.msu.ru/ )

. Kudryashov S.I. , Zorov N.B. Mendeleev Communications, p. 178 (1998). Abstract . The electric probe procedure developed here has made it possible to detect for the first time large cluster ions, the products of spinodal decomposition of the laser-induced labile state of the liquid phase of carbon, with a size up to a million atoms and relative content in the mass distribution of the order of ppm. Laboratory of Laser Diagnostics

Еще в разделе: (Показать все результаты (>410) - chem.msu.ru/ )

• Formation of large carbon clusters during laser ablation of foam graphite
• Publications of the Laboratory of Laser Diagnostics
• Science Department

e-mail: sachuk_ptz@mail.ru) , , , , - , middle class, regional features, stratification, criteria of belonging to the middle class, historical and cultural specifics of the region . The article focuses attention on prospects of regional researches of middle class. ... Also in article the an attempt to note the main regional features that influence on the main characteristics of the Russian middle class. the Russian distinctions of empirical stratification author takes number and ...

Еще в разделе: (Показать все результаты (>17) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2014/1/09.pdf

... Hobby >> Media >> Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: darktemplar ] . ... 30.09.2006 . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Angren ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Troop ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Anonymous ] . ...

Еще в разделе: (Показать все результаты (>860) - www.snto-msu.net/ )

... Hobby >> Media >> Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: darktemplar ] . ... 30.09.2006 . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Angren ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Troop ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Anonymous ] . ...

Еще в разделе: (Показать все результаты (>1593) - www.fds-net.ru/ )

• У кого есть Sims hot date или Livin'large или еще что-нибудь?? - Public forum
• Серьезные картинки - Public forum of MSU united student networks

... Air pollution induced changes in pine needle chemistry were observed at sample sites in the surroundings of the Pechenganikel smelter. ... Close to the pollution source needles were enriched in Ni and Cu by needle age. Correlation and principal component analyses show that changes in the element composition of pine needles depended on air pollution and on natural factors as well. The contribution from air pollution increased with needle age. ...

Еще в разделе: (Показать все результаты (>27) - eco.soil.msu.ru/ )

• Polluting metals in Russian terrestrial ecosystems: chemistry, dynamics, and
• CRITICAL LOADS OF ACID DEPOSITION IN EUROPEAN RUSSIA
• ASSESSMENT OF SOIL SUSTAINABILITY TO ACID DEPOSITION

День Физика . ... Новости . ... Абитуриентам . ... Главная Новости Наука . ... Новости сайта . ...

Еще в разделе: (Показать все результаты (>4) - www.dubinushka.ru/ )

. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . PDB . Classification . Domain instances . Bonded with NA . 1BMV . VIRUS/RNA . 1 . 0 . 1PGL . VIRUS/RNA . 1 . 1 . total (2 entries) . 2 . 1 . No comments on this family . Send your questions and comments to sas@belozersky.msu.ru .

Еще в разделе: (Показать все результаты (>249) - monkey.belozersky.msu.ru/ )

• PDB entries containing domains of the family "Basic region leucine zipper"
• PDB entries containing domains of the family "Sigma-70, region 4"
• SCOP classification

... Land Hydrology . ... Recreational Geography and International Tourism . ... Economic and Social Geography of Russia . ... Departments . ... Main accomplished research: River hydrology, limnology, hydrometry, water quality, flow hydraulics, hydrological predictions, fluvial processes, hydrophysics, hydrogeology, water management, water ecology. ... Large international conferences were organized by Hydrology Department for the last years – for example X Symposium on River Sedimentation (2007). ...

Еще в разделе: (Показать все результаты (>61) - eng.geogr.msu.ru/ )

• Arkhangelsk (Ustiayansk) station
• Publications
• Research laboratory of recent sediments and pleistocene paleogeography

. My house where I was born in 1959 (Tushino, Moscow Region). In 1942, during the World War II, a large aircraft bomb falls nearby this house. My grandmother with my mother and her sister were here, but this house remained standing. If this house were built now, the final would be another.

Еще в разделе: (Показать все результаты (>87) - chaos.phys.msu.ru/ )

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>232) - observ.pereplet.ru/ )

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>679) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~alex2308/align/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta

... Monitoring of relativistic electron fluxes in the near-Earth space. Development of the methods for studying of relativistic electrons of fluxes in the regions of precipitation. Studies of the fluxes and spectra of high-energy electrons of the outer radiation belt of the Earth. ... Studies of the fluxes and spectra of high-energy electrons in the low-latitudinal regions (at small L). ... Studies of VLF electromagnetic radiation generated during the main phase of the lightning discharge. ...

Еще в разделе: (Показать все результаты (>8) - vernov-relec.sinp.msu.ru/ )

Asymptotic behavior of form factor of the composite system at large momentum transfer. ... Comparison of predictions CQM and pQCD for the pion in the Instant form of relativistic quantum mechanics The electromagnetic current matrix element for pion: p | ... Asymptotic behavior of the pion form factor for Q 2 · Pointlike quarks: d d u u GE (Q 2 ) + GE (Q 2 ) = 1, GM (Q 2 ) + GM (Q 2 ) = 1 Ї Ї F (Q 2 ) quarks: 25/2 M - e Q QM 4b 2 1+ 7b2 2MQ . ...

Еще в разделе: (Показать все результаты (>152) - qfthep.sinp.msu.ru/ )

• BULLETIN No.1