... Publication data for the ACAT'2002 Proceedings are available (you may download also a Word file ). ... Information on publication of the ACAT'2002 Proceedings and instructions on submission of contributions are available on our Web site. ... Everybody is invited to send interesting pictures! ... Materials (slides etc) of poster presentations appear in our Web data base (check "Programme" page). ... SLIDES of tutorials are available (check "Tutorials" page, then go to particular tutorial page). ...

Еще в разделе: (Показать все результаты (>52) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/page0.html
• http://acat02.sinp.msu.ru/24june.html
• http://acat02.sinp.msu.ru/26june.html

PHP Manual . ... PHP 3 <= 3.0.18, PHP 4 >= 4.0.0) pg_locreate -- Create a large object . int pg_locreate ( resource connection) . pg_locreate() creates an Inversion Large Object and returns the oid of the large object. connection specifies a valid database connection opened by pg_connect() or pg_pconnect() . PostgreSQL access modes INV_READ, INV_WRITE, and INV_ARCHIVE are not supported, the object is created always with both read and write access. ... It returns large object oid otherwise. ...

Еще в разделе: (Показать все результаты (>246) - oit.cmc.msu.ru/ )

• Common Pitfalls
• PostgreSQL functions
• pg_loopen

... The role of wine tax-farming system in the forming of large capitals in Russia in the 19th century, . ... The article is devoted to one of the most profitable business activities in Russia at the end of the 18th century to the beginning of the 1860s. The author researches the social and national structure of wine tax-farmers, the level of their incomes as well as the ways and methods of accumulation of capital, in particular, their ties with the aristocracy and state officials of all levels. ...

Еще в разделе: (Показать все результаты (>6439) - hist.msu.ru/ )

... J. 15(1): 33-34 ї RUSSIAN ENTOMOLOGICAL JOURNAL, 2006 A new Aphodius species of the subgenus Sinodiapterna from Far East Russia (Coleoptera: Scarabaeidae) Новый вид Aphodius подрода Sinodiapterna с Дальнего Востока России (Coleoptera: Scarabaeidae) A.A. Gusakov А.А. Гусаков Zoological Museum of the Moscow Lomonosov State University, Bolshaya Nikitskaya 6, Moscow 125009, Russia. ... KEY WORDS: Coleoptera, Scarabaeidae, Aphodius, new species, Far East of Russia. ...

Еще в разделе: (Показать все результаты (>1341) - zmmu.msu.ru/ )

• Hemprich's bat
• Tropical centre
• Mammalian humerus from the Early Cretaceous of West Siberia.

OLEA EUROPAEA (OLIVE) OLIVE TAXONOMY Kingdom: plantae Order: lamiales Family: Oleaceae Genus: Olea Species: O. Europaea MORPHOLOGY Root System: great root system allows tree to grow in dry climates could grow from 15cm to 6 meters depending on the climate and type of soil Trunk: younger trees have smooth gray/green bark. ... HARVESTING Harvesting for Oil Step 1 Harvest as soon as the fruit reaches maximum size. ... Tree shakers and mechanical rakes can also be used when harvesting olives for oil. ...

Еще в разделе: (Показать все результаты (>1047) - herba.msu.ru/ )

• http://herba.msu.ru/shipunov/school/biol_240/en/open/cochlearia_c.txt
• Insect catching and carnivorous plants
• Systema Naturae

... Gas bubbles in living tissues, when subjected to therapeutic ultrasound (TUS), may be found in relatively large cavities such as blood vessels, in intercellular spaces and within cells. ... For greater TUS intensity, when bubble might collapse near a surface, we study bubble behavior in confined space that simulates a tiny cavity such as intercellular space. ... In some cases, the bubble divides into two symmetrical bubbles that collapse while high velocity jets are generated, aiming at the walls. ...

Еще в разделе: (Показать все результаты (>216) - acs366.phys.msu.su/ )

• Schedule : Nonlinear Acoustics and Flows, Instabilities, Turbulence, and
• ISNA-16
• Schedule : Nonlinear Acoustics of the Atmosphere, the Ocean, and the Earth

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>693) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~alex2308/align/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta

Stephen Price (Southampton U) Q: The difference of theoretical and experimental patterns is rather high, why? The difference between the experimental and theoretical patterns is large in the case of the Cu and Pd EXAFS because only the first nearest neighbour shell is fit, that only the atoms within 3 е of the absorber. In contrast, the Au EXAFS is fit up to 6 е and so the theoretical and experimental patterns is much less. ... Q: What was the technology of underpotential deposition? ...

Еще в разделе: (Показать все результаты (>19) - www.elch.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/mole/lecture/nazmutdinov.pdf

Laboratory of Informatics . Head of Laboratory E.S.Polischuk, senior researcher, DSc . ... research guidance of a four year student's project in the Faculty of Geography (N.M. Chernavskaya, DSc) . ... Grant of RFBF (Russian Foundation for Basic Research) 01-03-00332, the head of the project prof. R.B.Rybakov, Institute of Orientalistic (Russian Academy of Science), N. M. Chernavskaya - performer . ... N.M.Chernavskaya, DSc, senior researcher, T.B.Pleskacheva., DSc, senior researcher. ...

Еще в разделе: (Показать все результаты (>87) - srcc.msu.ru/ )

• Brandenburg A., Sokoloff D., Subramanian K., Current status of turbulent dynamo
• Arshakian T. G., Stepanov R., Beck R., Krause M., Sokoloff D. Simulations of
• D.Moss, R.Stepanov, T.G.Arshakian, R. Beck, M.Krause, D.Sokoloff, Multiscale

... List of Publications . ... L.N. Rashkovich, A.S. Filonov, and I.V. Yaminsky, Shape of Steps on the (010) Face of Orthorhombic Lysozyme Crystals - Crystallography Reports, 2008, 53(2), 320-325. ... I.V. Yaminsky, A.S. Filonov, A.V. Bolshakova, N.I. Nikonorova, Local Properties Study of Nanostructured Materials via Internet Probe Microscopy // Lomonosov Conference 2007, Moscow, April, 2007, Conference Proceedings . ... E.V. Dubrovin, A.S. Filonov, G.B. Meshkov, O.V. Sinitsyna, I.V. Yaminsky. ...

Еще в разделе: (Показать все результаты (>157) - www.spm.genebee.msu.ru/ )

• Evgeny Menshikov
• List of my publications issued in 1996-2002
• List of my publications issued in 2003-

XAFS spectroscopy is widely used in physics, materials science, chemistry (especially in catalysis and coordination chemistry), biology, geochemistry and environmental science. ... This is an interface to the Glimpse -based search engine which enables you to find published papers in different fields of x-ray absorption spectroscopy -- XAFS, EXAFS, XANES, NEXAFS, SEXAFS, XEOL, and EXAFS-like phenomena in photoemission, electron-energy-loss spectra and so on. ... Database Search Form . ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

... About CIE MSU . Academic Programmes . Admissions . ... Vestnik CIE (in Russian) . ... Homepage > Admissions > . Study Periods . 2014-2015 academic year . ... One academic year programme: . September 2014 - June 2015 . Arrival Dates . ... August 28 October 31 . June 2015 . One and a half academic year programme: . ... STUDY PROGRAMMES AND COURSE DATES . ... September 20 15 - June 20 16 . ... Study Period . ... Recommended Arrival Dates . ... June 2 6 June 29 . ...

Еще в разделе: (Показать все результаты (>24) - www.cie.ru/ )

General Information . ... The conference is organized by the Sternberg Astronomical Institute (SAI) of Moscow University and the IAU Working group "Site-testing Instruments" . ... Use of site data in telescope operation and adaptive optics. ... Recent conferences on this subject (2007, 2008) demonstrated great interest of the community, hence the need for a new meeting. ... Unlike previous recent conferences, this meeting will cover all aspects of site monitoring for optical/IR astronomy. ...

Еще в разделе: (Показать все результаты (>29) - site2010.sai.msu.ru/ )

• Observatories

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>23) - observ.pereplet.ru/ )

• Images

General Information . ... Scientific research . ... For physics faculty . ... Department of General Physics and Magneto-Ordered Matter is one of the largest Chairs of Physical Faculty of Lomonosov Moscow State University with long-standing traditions and a numerous community of high qualification teaching personnel and researchers, performing research in the most actual fields of condensed matter physics and teaching graduates in magnetic and ferroelectric phenomena. ...

Еще в разделе: (Показать все результаты (>35) - ferro.phys.msu.ru/ )

... MPI_Offset Type . ... Physical File Layout Previous: Miscellaneous Clarifications . MPI_Offset is an integer type of size sufficient to represent the size (in bytes) of the largest file supported by MPI. Displacements and offsets are always specified as values of type MPI_Offset. ... In Fortran 77 environments that do not support KIND parameters, MPI_Offset arguments should be declared as an INTEGER of suitable size. ... Центры . ...

Еще в разделе: (Показать все результаты (>505) - www.parallel.ru/ )

• File Offsets | PARALLEL.RU - Информационно-аналитический центр по параллельным
• FFTW - Footnotes | PARALLEL.RU - Информационно-аналитический центр по
• Decoding a Datatype | PARALLEL.RU - Информационно-аналитический центр по

Contemplating the evolution of Surface Nonlinear Optics seems to be highly instructive, able to stimulate one's own creativity and deeper understanding of current trends in this field. ... Hence, the Surface Nonlinear Optics Map, in its starting version, presents the names of researchers having made prominent scientific contributions to this branch of Optics. Related websites are accessible by clicking the corresponding names. ...

Еще в разделе: (Показать все результаты (>51) - shg.phys.msu.ru/ )

• List of selected publications

... 11- 0++ 0 KK BR = 83% (1020) a0(980) f0(980) BR ~ O(10 ' s BR = 6.210 BR = 15% BR = 1.3% BR = 1.310 T (1GeV) 80 nb scan MeV pb KLOE 2001-2005 data ISR s W s s ger Tag KLOE : Fv(W) in e+e-+-() sity o min Lu BR(KS 3 0): UL KS 3 0 CP violating not yet observed -9 SM (ChPT): BR(KS 3 0) = 1.9·10 data 2 ev/bkg New KLOE2013: PLB723( 2013 ) 54 L=1.7 fb-1 indepen improved selection signal eff. ( ... A(X,Y)|2=N(1+aY+bY2+dX2+fY3+gX2Y) New analysis PRELIMINARY (no syst. ): f0 confirmed fits with g......

Еще в разделе: (Показать все результаты (>186) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/210809/Teryaev_lom09.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/240809/Weiser.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/250809/Polikarpov/polikarp.pdf

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Online . ... More than 40 000 students (graduate and postgraduate) and about 7 000 undergraduates study at the university, and over 5 000 specialists do the refresher course here. ... Moscow University campus is an extremely complex system, with its 1 000 000 m2 floor area in 1 000 buildings and structures, with its 8 dormitories housing over 12 000 students and 300 km of utility lines. ...

Еще в разделе: (Показать все результаты (>100) - www.msu.ru/ )

... Publications . ... SPDC Laboratory . Quantum Electronics Chair . ... Error: You currently have Javascript disabled. ... 11 , 065203 (2014). ... Quantum key distribution (QKD) is a concept of secret key exchange supported by fundamentals of quantum physics. ... Download [ help ]: . Download paper: doi page . Download paper: link to publisher . ... All persons copying this information are expected to adhere to the terms and constraints invoked by each author's copyright. ...

Еще в разделе: (Показать все результаты (>127) - qi.phys.msu.ru/ )