AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>200) - www.genebee.msu.ru/ )

... О физическом факультете . ... Физический факультет . ... История факультета . ... Журнал "Ученые записки физич. факультета МГУ" . ... Журнал "Ученые записки физического факультета МГУ" . ... Серия "Выдающиеся ученые физического факультета МГУ" . ... М.: Физический факультет МГУ им. М.В.Ломоносова . ... под редакцией К.В.Показеева -- М.: Физический факультет МГУ, 2015, 376 с. Г.А.Сарданашвили . ... М.: Физический факультет МГУ . ... Константин Петрович Белов" (Серия: Выдающиеся ученые физического . ...

Еще в разделе: (Показать все результаты (>159) - phys.msu.ru/ )

• Задачи вступительных экзаменов

... Publication data for the ACAT'2002 Proceedings are available (you may download also a Word file ). ... Information on publication of the ACAT'2002 Proceedings and instructions on submission of contributions are available on our Web site. ... Everybody is invited to send interesting pictures! ... Materials (slides etc) of poster presentations appear in our Web data base (check "Programme" page). ... SLIDES of tutorials are available (check "Tutorials" page, then go to particular tutorial page). ...

Еще в разделе: (Показать все результаты (>49) - acat02.sinp.msu.ru/ )

... 2013 . ... Publications . ... Number of publications 0 . ... 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 . ... Publication type . ... Borisov A. V. , Kozlov V. V. , Mamaev I. S. Proceedings of the IUTAM Symposium on Hamiltonian Dynamics, Vortex Structures, Turbulence (Moscow August 25-30, 2006) . Dordrecht Springer, 2006, 512 . ... Institute of Computer Science Izhevsk, 2005 - 2016 . ...

Еще в разделе: (Показать все результаты (>218) - ics.org.ru/ )

Alders in the European Russia: thesis , poster (PDF) and article . Carnivorous plants: . ... Nymphaea : . ... Morphological variability of Nymphaea alba L. s.l. (Nymphaeaceae) in the European Russia . Morphological variation in Nymphaea (Nymphaeaceae) in European Russia: 2006 and 2008 [PDF] . Evolutionary dynamics across discontinuous freshwater systems: Rapid expansions and repeated allopolyploid origins in the Palearctic white water-lilies ( Nymphaea ) [PDF] . ...

Еще в разделе: (Показать все результаты (>1249) - herba.msu.ru/ )

• What's new?
• Instruction to authors
• Stability of leaf form and size during herbarization

... Russian Pages . CDFE: Home Page . ... Numerical data, graphics, and bibliography . ... description] . Last updated: May 6th, 2014 . ... Last updated: June 15th, 2011 . ... Last updated: . ... Last updated: April 4th, 2015 . ... Last updated: February 25th, 2016 . ... Last updated: September 27th, 2011 . ... Photonuclear Data Index since 1955 . ... Last updated: September 15th, 2015 . ... Last updated: March 22th, 2010 . ... Last updated: March 19th, 2015 . ... Last updated: May 15th, 2002 . ...

Еще в разделе: (Показать все результаты (>45) - cdfe.sinp.msu.ru/ )

• CDFE Activities
• EXFOR Search Engine

... MCCME, Moscow 3 papers and (a) English edition of the textbook "Probability", vol. ... Springer, Berlin, 2006. ... 4 C. Conferences (as a participant): Ї Plenary talk at the Conference on Probability Theory and Mathematical Statistics dedicated to the centenary of A. N. Kolmogorov (September 21ґ27, 2003, Tbilisi, Georgia); Ї Plenary talk at the Franco- Russian Colloquium Perspectives de coopЄ ation en informatiques et mathЄ er ematiques appliquЄ ees (October 2003, Moscow ); Ї Plenary ...

Еще в разделе: (Показать все результаты (>69) - new.math.msu.su/ )

2010 . ... In Functionalized Inorganic Fluorides: Synthesis, Characterization and Properties of Nanostructured Solids Edited by Alain Tressaud, 2010 John Wiley & Sons, Ltd chapter 14, P.423-468 . D.O.Charkin, A.V.Sadakov, O.E. Omel?yanovskii, S.M. Kazakov Synthesis, crystal structure, and properties of novel perovskite oxychalcogenides, Ca 2 CuFeO 3 Ch (Ch = S, Se) // Materials Research Bulletin 45 (2010) 2012?2016 . Dmitri O. Charkin, Dmitri N. Lebedev, ,Sergey Yu. ...

Еще в разделе: (Показать все результаты (>81) - www.inorg.chem.msu.ru/ )

• Prof. Dolgikh group. Publications 2007
• Prof. Dolgikh group. Publications 2003
• Prof. Dolgikh group. Publications 1995-1999

Call Title: Call for proposals for ERC Starting Independent Researcher Grant Call identifier: ERC -2012-StG Date of publication: 20 July 2011 Electronic proposal submission deadlines1 (single submission of full proposal): 2 Domain Physical Sciences Engineering (Panels PE1 - PE10): 12 October 2011, 17.00.00 (Brussels local time) Domain Life Sciences (Panels LS1 ґ LS9): 9 November 2011 17.00.00 (Brussels local time) Domain Social ... See section 4.6 and Annex 9 of the work programme. ...

Еще в разделе: (Показать все результаты (>37) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/press_release_StG_2012.pdf
• http://ideas.msu.ru/docs/CSA_call_2009.pdf

... 3 (2): 107108 ? RUSSIAN JOURNAL OF THERIOLOGY, 2004 Obituary Vadim Aleksandrovich Topachevskiy (19302004) On November 9, 2004, the great Ukrainian and globally renowned theriologist and palaeontologist passed away in Kiev on his 74th year. Professor Vadim A. Topachevskiy was born on July 16, 1930. ... Due to the leadership of Prof. Topachevskiy the modern Paleontological Museum of NMNH of National Academy of Sciences became popular and one of the well known in Eastern Europe. ...

Еще в разделе: (Показать все результаты (>1368) - zmmu.msu.ru/ )

• http://zmmu.msu.ru/bats/biblio/glush_06.pdf
• Tsytsulina Katerina
• Наши поездки: по разным странам

Open Conference Systems . ... Conference Content Search . All Authors Title Abstract Index terms Full Text . ... January February March April May June July August September October November December 01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 0 . ... By default only papers containing all terms in the query are returned (i.e., AND is implied) . Combine multiple words with OR to find papers containing either term; e.g., education OR research . ...

Еще в разделе: (Показать все результаты (>23) - hea.phys.msu.su/ )

... Nonlinear fiber optics . ... member of the Editorial Board for the Laser Physics journal . ... Member of the steering committee of the international conference on Raman spectroscopy (ICORS): Budapest, 2002; Brisbane, 2004; Yokohama, 2006; London, 2008 . Member of the steering committee of the International Laser Physics workshop: Bratislava, 2002; Hamburg, 2003; Trieste, 2004; Kyoto, 2005; Lausanne, 2006; Leon, 2007; Trondheim, 2008; Barcelona, 2009 . ... International conference ?Laser Optics? ...

Еще в разделе: (Показать все результаты (>46) - photonicslab.phys.msu.ru/ )

... Measurement of the MASS detectors parameters with mass program January 24, 2015 [112707] . MASS/DIMM electronics. ... Turbina-core(D): Dimm User Guide. ... N.Shatsky, V.Kornilov, The revision of the MASS/DIMM star catalogue. ... О.Возякова, В.Корнилов, Н.Шатский, Новое программное обеспечение прибора MASS/DIMM. ... V.Kornilov, N.Shatsky, S.Potanin, O.Voziakova, B.Safonov Preliminary results of astroclimate parameters measurements at the Sternberg 2.5m telescope installation site. ...

Еще в разделе: (Показать все результаты (>20) - curl.sai.msu.ru/ )

... While RPM's build root requires a certain amount of spec file and make file tweaking in order to get it working properly, directing RPM to perform the build in a different directory is a snap. ... RPM's build area consists of five directories in the top-level: . ... The next step in getting RPM to use a different build area is telling RPM where the new build area is. ... exit 0 Executing: %build + cd /home/ed/mybuild/BUILD + cd cdplayer-1.0 + make gcc -Wall -O2 -c -I/usr/include/ncurses cdp.c ? ...

Еще в разделе: (Показать все результаты (>469) - uneex.lorien.cs.msu.su/ )

• Different Places an rpmrc File Resides
• Conditionals
• Scope of license

... My host university was Stanford University in California. ... Some of my impressions about the United States and the people of that country are in it, and I thought some pages from my diary would be interesting for you. ... Today the orientation is over. ... Soon I will be in Palo Alto. ... It was the one big problem. ... A few days before I had been in despair. ... I have a room on the first floor. ... Today we (Carol and I) attended a divine service at St. Mark's Episcopal Church in Palo Alto. ...

Еще в разделе: (Показать все результаты (>146) - www.prof.msu.ru/ )

• European Internet Network Seeks Publication Contributors
• American Center Moscow- November 2006
• Conferences & Publications

Lomonosov project . News . ... Mikhail Lomonosov . Scientific goals . ... UFFO . ... October 9, 2011 . The ?Lomonosov? project was presented at the Russian Science Festeval. ... The connecting operation between the scientific equipment of the Lomonosov project and scientific telemetric system was started at joint stock company ?Russian Space Systems?. ... The flying model of UFFO device has arrived. ... The ?Lomonosov? project was presented at the international aerospace show MAKS 2011. ...

Еще в разделе: (Показать все результаты (>59) - lomonosov.sinp.msu.ru/ )

• Scientific goals | Университетский спутник "Ломоносов"
• Publications | Университетский спутник "Ломоносов"
• BDRG | Университетский спутник "Ломоносов"

... 14th CMS RDMS Conference, Varna, Bulgaria + Balchik, Albena, Sofia, 6-11.09.2010 (64 photos) . ... CERN, LHC Point 5, CMS Control Room, 03-08.11.2009 (31 photos) . ... CMS visit and CMS Xmas Party, Point 5, CERN, France 13.12.2007 (29 photos) . ... CMS, Point 5, CERN, France 16.07.2006 (13 photos) . ... CMS Xmas Party, Point 5, CERN, France 6.12.2006 (10 photos) . ... CMS Xmas Party, Point 5, CERN, France .12.2005 (10 photos) . ... Sergey Petrushanko sergeant@mail.cern.ch . ...

Еще в разделе: (Показать все результаты (>100) - lav01.sinp.msu.ru/ )

• Activity of Igor Lokhtin
• Home Page of A. Demianov
• Sergey Petrushanko Participation in Schools and Conferences

... Positional containers are referred by id, for instance =#patternSideBar=. ... Page type classes * .patternViewPage * .patternViewPage .patternPrintPage * . patternNoViewPage * . patternNoViewPage .patternEditPage * . patternNoViewPage .patternAttachPage * . patternNoViewPage .patternChangeFormPage * . patternNoViewPage .patternDiffPage * . patternNoViewPage .patternRenamePage * .patternSearchResultsPage * .patternPlainPage (=viewplain.pattern.tmpl=) ---++ Layout classes * Main layout ...

Еще в разделе: (Показать все результаты (>5464) - wiki.cmc.msu.ru/ )

• PatternSkinCssCookbook < System < Foswiki
• TopicsAndWebs < System < Foswiki

... Wiki . ... wiki: WikiProcessors . ... Processors can be thought of as macro functions to process user-edited text . ... Besides their content, some Wiki processors can also accept parameters , which are then given as key=value pairs after the processor name, on the same line. ... Example 3 : Searching tickets from a wiki page, by keywords. {{{ #!html <form action="/query" method="get"><div> <input type="text" name="keywords" value="~" size="30"/> <input type="submit" value="Search by Keywords"/> <!-...

Еще в разделе: (Показать все результаты (>1592) - kodomo.cmm.msu.ru/ )

• Department of animal cell biochemistry - Staff and contacts
• Department of animal cell biochemistry - Publications
• Untitled Document

... Manuscript Submission . Publication Procedure . ... After the refereeing process is complete, the manuscripts may be declined or returned to the authors for revisions, or accepted for publication. ... The best way to learn how to format the manuscript is to look at several papers already published in the journal. ... Moscow: Moscow University Press, 1969. ... The manuscript of the manuscript> is submitted for publication in the on-line journal "Vychislitel?nye Metody i Programmirovanie". ...

Еще в разделе: (Показать все результаты (>172) - num-meth.srcc.msu.ru/ )

• Publication Ethics and Publication Malpractice Statement
• Supercomputer molecular modeling of thermodynamic equilibrium in gas-metal
• General Information