... Air pollution induced changes in pine needle chemistry were observed at sample sites in the surroundings of the Pechenganikel smelter. ... Close to the pollution source needles were enriched in Ni and Cu by needle age. Correlation and principal component analyses show that changes in the element composition of pine needles depended on air pollution and on natural factors as well. The contribution from air pollution increased with needle age. ...

Еще в разделе: (Показать все результаты (>36) - eco.soil.msu.ru/ )

• TRANSFORMATION AND STABILITY OF SOILS IN FOREST ECOSYSTEMS UNDER IMPACT OF

. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . PDB . Classification . Domain instances . Bonded with NA . 1BMV . VIRUS/RNA . 1 . 0 . 1PGL . VIRUS/RNA . 1 . 1 . total (2 entries) . 2 . 1 . No comments on this family . Send your questions and comments to sas@belozersky.msu.ru .

Еще в разделе: (Показать все результаты (>5463) - monkey.belozersky.msu.ru/ )

• SCOP classification

... Moscow, Russia . ... March-October 2000 . ... Gusev A.S. Multicolor CCD Photometry of Six Lenticular and Spiral Galaxies. ... Gusev A.S., Park M.-G. Structure and stellar population of ringed barred galaxy NGC 2336 // Astronomy and Astrophysics, 2003, V.410, P.117-129. ... Gusev A.S. Photometric Properties of Bars in Galaxies // Astronomy Reports, 2000, V.44, N9, P.579-591. ... Gusev A.S. BVRI CCD Photometry of Pecular Galaxies NGC 5605 and NGC 5665 // Astronomy Reports, 2000, V.44, N9, P.569-578. ...

Еще в разделе: (Показать все результаты (>539) - lnfm1.sai.msu.ru/ )

• Maidanak Lab page
• List of publications
• Data bases of Natural Satellites. Documentation. Sources

LABORATORY . ... It was founded by two young Candidates of Philology who had just got their scientific degrees Boris Andreevich Uspensky and Vladislav Mitrofanovich Andruschenko as interdepartmental laboratory based on three departments: the English Language Department of the Philological Faculty, Foreign Languages Department for the Humanities and Arabic Department of the Institute for Asia and Africa. ... Vladislav Mitrofanovich Andruschenko was at the Head of the Laboratory from 1964 till 1983. ...

Еще в разделе: (Показать все результаты (>65) - lcl.srcc.msu.ru/ )

... Our idea is to virtually commemorate this together around the world with every one of the more than 60 Fulbright alumni association participating with small or large events and in a joined communication of what Fulbright is all about. ... In addition we plan to discuss the plans further throughout the Athens Fulbright conferences in October. ... Thanks to Wiltrud for starting this important conversation about the commemoration of the centenary of Senator Fulbright's birth. ...

Еще в разделе: (Показать все результаты (>130) - www.prof.msu.ru/ )

• WHICH UNIVERSITY SYSTEM IS BEST?
• Conferences & Publications

... The Council on Complex Problems of Cosmic Rays of the Russian Academy of Sciences and the Skobeltsyn Institute of Nuclear Physics (SINP) of Lomonosov Moscow State University are planning to held a workshop "Cosmic Ray Physics Large Scale Experiments at the Second Decade of the 21st Century" on May 16-18 2011 at the Moscow State University. ... The Workshop banquet will be held on Tuesday, May 17 th . ... Workshop тАЬCosmic Ray Physics Large Scale Experiments at the Second Decade of the 21st Century"...

Еще в разделе: (Показать все результаты (>7) - tunka.sinp.msu.ru/ )

... The role of wine tax-farming system in the forming of large capitals in Russia in the 19th century, . ... The article is devoted to one of the most profitable business activities in Russia at the end of the 18th century to the beginning of the 1860s. The author researches the social and national structure of wine tax-farmers, the level of their incomes as well as the ways and methods of accumulation of capital, in particular, their ties with the aristocracy and state officials of all levels. ...

Еще в разделе: (Показать все результаты (>3299) - hist.msu.ru/ )

• Visual Images of Patriarch Nikon

... J. 15(1): 33-34 ї RUSSIAN ENTOMOLOGICAL JOURNAL, 2006 A new Aphodius species of the subgenus Sinodiapterna from Far East Russia (Coleoptera: Scarabaeidae) Новый вид Aphodius подрода Sinodiapterna с Дальнего Востока России (Coleoptera: Scarabaeidae) A.A. Gusakov А.А. Гусаков Zoological Museum of the Moscow Lomonosov State University, Bolshaya Nikitskaya 6, Moscow 125009, Russia. ... KEY WORDS: Coleoptera, Scarabaeidae, Aphodius, new species, Far East of Russia. ...

Еще в разделе: (Показать все результаты (>1299) - zmmu.msu.ru/ )

• http://zmmu.msu.ru/files/images/spec/Russ%20Ent%20J/ent16_4%20457_458.pdf
• Hemprich's bat
• Exhibition of Reptiles

... Gas bubbles in living tissues, when subjected to therapeutic ultrasound (TUS), may be found in relatively large cavities such as blood vessels, in intercellular spaces and within cells. ... For greater TUS intensity, when bubble might collapse near a surface, we study bubble behavior in confined space that simulates a tiny cavity such as intercellular space. ... In some cases, the bubble divides into two symmetrical bubbles that collapse while high velocity jets are generated, aiming at the walls. ...

Еще в разделе: (Показать все результаты (>187) - acs366.phys.msu.su/ )

• Abstract (Invited)

. General Information . Media Files . Participants . Timetable . Local Information . Photos . Back to the album list . Previous Click the image to view it in fullsize. Previous . The BTA (Bolshoi Teleskop Alt-azimutalnyi, Eng:Large Altazimuth Telescope) is a large 6 m optical telescope at the Special Astrophysical Observatory. The BTA-6 was the largest telescope in the world between its first light in 1975 and 1993.

Еще в разделе: (Показать все результаты (>197) - site2010.sai.msu.ru/ )

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>1381) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~alex2308/align/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta_aligned.fasta

The Ecological Cooperation Project is the first large-scale children's network project in Russia. This project was founded on the principles of development and achievement of widespread nature awareness among Russian school children through the establishment and unification of numerous childrenтАЩs ecological projects. ... Nature Protected Areas . ... The Project is open for cooperative learning, and any childrenтАЩs ecological organization or group is welcome to participate. ...

Еще в разделе: (Показать все результаты (>19) - www.ecocoop.ru/ )

• For three and half years of activity the participants of Ecological Cooperation

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

54. http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/research_interests...

55. http://www.elch.chem.msu.ru/mole/lecture/qprice.pdf

56. Laboratory of Informatics

57. http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/18.pdf

58. Yes my Children, it CAN be DONE!

59. Allocating swap space

60. http://fgp.msu.ru/wp-content/uploads/2014/09/UNESCO_CHAIR-1.pdf