... Supercomputer molecular modeling of thermodynamic equilibrium in gas-metal microsystems" . Podryga V.O., Polyakov S.V., and Puzyrkov D.V. This paper is devoted to the supercomputer modeling of thermodynamic equilibrium in microsystems containing different substances in various aggregate states. ... Podryga V.O. тАУ Keldysh Institute of Applied Mathematics, Russian Academy of Sciences; Miusskaya ploshchadтАЩ 4, Moscow, 125047, Russia; Ph.D., Scientist, e-mail: pvictoria@list.ru . ...

Еще в разделе: (Показать все результаты (>135) - num-meth.srcc.msu.ru/ )

• "Automatic detection and description of supercomputer network infrastructure"

... Book 1 Containing the years from the beginning of the World, or from the year of the Juliam Period 730 unto the third of Solomon, which is the 3702 year of the same Period . ... Book 5 Containing years from the first of CHRIST to the Thirty fourth . Book 6 Wherein are contained the years from the 304 of CHRIST unto 491 . Book 7 Wherein are contained the years from the 491 of CHRIST unto 641 . Book 8 Wherein are contained the years from the 641 of CHRIST unto 1100 . ...

Еще в разделе: (Показать все результаты (>80) - hbar.phys.msu.ru/ )

e-mail: dk89@mail.ru) , , , , John Foran, revolution, postmodern, globalization, political cultures of opposition "" . The article presents John Foran's experience of bulding a theory of postmodern revolution based on overcoming the discourses of "the end" of modern revolution theorie's components. ... It contains the experience of postmodern and modern revolution's components compare in the baise of concept of political culture of opposition. ...

Еще в разделе: (Показать все результаты (>29) - vestnik.socio.msu.ru/ )

METHODICS AND TECHNOLOGY OF REGIONAL OLYMPIADS IN PROGRAMMING FOR STUDENTS Uskova O.F., Gorbenko O.D. (Voronezh) The article is devoted to experience of regional student Olympiads in programming and computer modeling arrangement, it contains some examples of tasks, offered during Olympiad. 2001 ( 0054) 2002 ( 0140) . 2001 : . ... 2001 700 ( ), 1000 2002 ( ). ... 200 . ... N ( 2 <= N <= 100 ) . ... 10, 2002, .151-159 100%. 150%, 200%. ... 100%, 150% 200% . ... 160 . ... 0140) 160 ...

Еще в разделе: (Показать все результаты (>148) - www.mce.biophys.msu.ru/ )

• Heat transfer in non-uniform by structure monodisperse system, containing
• Books : Business Communication / Деловое общение

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... Problems and tasks of the research programme . ... Research programme and research problems . ... Glossary of the laboratory-chair . ... Forms of co-operation and communication methods< . ... On the Institute . ... The International Society for the Study of Time . ... Laboratory-chair of modelling the natural references of time . ... Co-operation with the Laboratory-chair of modelling the natural references of time can be carried out in the following mutually complementary forms. ...

Еще в разделе: (Показать все результаты (>331) - chronos.msu.ru/ )

• M.Saniga. The Psychopathology of Time and Its Algebraic Geometrical Patterns

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>52) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

Next] [Previous] [Top] [Contents] [Index] [netCDF Home Page] [Unidata Home Page] . ... The Unidata Program Center has developed a units library to convert between formatted and binary forms of units specifications and perform unit algebra on the binary form. Though the units library is self-contained and there is no dependency between it and the netCDF library, it is nevertheless useful in writing generic netCDF programs and we suggest you obtain it. ... Celsius . ... nit (unit of photometry) . ...

Еще в разделе: (Показать все результаты (>77) - angel.cs.msu.su/ )

• : Interface AttributeSet
• : Interface DimensionSet
• : Class Schema

... Instructions are in README.TXT file inside the tarball. ... tar -xvf nhunt_x86.tar Query and database files should contain sequences in FASTA format ( wikipedia description ). ... Default name of the output file is 'nhunt.out'. ... Any parameter consists of key and value and is called as '-key value', where 'key' is one character and 'value' is any number of characters. -i Query file . ... No default value. -d Database file . ... No default value. -o Output file . ... Default value: 'nhunt.out' . ...

Еще в разделе: (Показать все результаты (>14) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

. [ Войти ] . Главная -> Фильмы -> Container . Пользователи . Демо . Деньги . Фильмы . Форум . Container . Контейнер . Швеция 2006 . отметить . Драма . Lukas Moodysson . Mariha ?berg . Peter Lorentzon . Jena Malone .

Еще в разделе: (Показать все результаты (>77) - kinfo.ru/ )

• Commingled Containers - Фильмы - Kinfo.ru
• The Cycle of Communication - Фильмы - Kinfo.ru

... GeneBee . ... Courses in Bioinformatics . ... What is GCG? ... Usage of GCG Package on GeneBee Server . ... What is WhatIf? ... Computer Class . ... Due to colaborate work of many laboratories the total length of published nucleotide sequences is now . ... GCG vs. ... Usage of GCG Package on GeneBee server . ... Computer class . ... Computer class is used for bioinformatic courses and for scientific semenars. ... Everyone who need a consultation for GeneBee service, GCG or WhatIf package is welcomed...

Еще в разделе: (Показать все результаты (>182) - www.genebee.msu.ru/ )

• RNA secondary structure prediction
• Screening pattern or alignmemt against PROTEIN databank
• BLAST Frequently Asked Questions (FAQ)

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>797) - zmmu.msu.ru/ )

... Structure and properties of chimeric small heat shock proteins containing yellow fluorescent protein attached to their C-terminal ends. ... Recombinant chimeras of small heat shock proteins (sHsp) HspB1, HspB5, and HspB6 containing enhanced yellow fluorescent protein (EYFP) attached to their C-terminal ends were constructed and purified. Some properties of these chimeras were compared with the corresponding properties of the same chimeras containing EYFP attached to the N-terminal end of sHsp. ...

Еще в разделе: (Показать все результаты (>39) - biochem.bio.msu.ru/ )

• Cardioprotective effect of histidine-containing dipeptides in pharmacological

Home People Activities Research Publications . ... Containers for image storage in memory, reading and writing of image files, Pipeline filtering library, D.Yurin "On the Images Pipe Line Filtering, PDF , color spaces, fast convolutions, image registration algorithms, edge curvature estimation via differential invariants (under development) , Bresenham algorithms, some numerical algorithms etc. ... Download help on project (CHM) , generated via doxygen (see How to document program's code ) . ...

Еще в разделе: (Показать все результаты (>11) - imaging.cs.msu.ru/ )

... Stress-Dependent Complementary Variations in P- and S-Wave Velocities for Rocks Containing ? High-Compliance Porosity: an Effective-Medium Model and Comparison with Experiments . ... A 3D effective-medium model describing variation in rock elastic moduli due to presence of high-compliant defects is considered. ... The ratio of the normal-to-shear compliance of the defects was determined for different rock samples. The results confirmed that, in saturated rocks, defect?s shear compliance dominates. ...

Еще в разделе: (Показать все результаты (>113) - acs366.phys.msu.su/ )

• ISNA-16 Homepage

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>131) - hist.msu.ru/ )

• Economic History. Yearbook. 2001
• Labour recruiting policy and the Nobel Association of Oil Producers. A Set of
• Moscow State University. Faculty of History. An Application

Expression regulation of desiccation-resistance genes in Polypedilum vanderplanki Pavel Mazin Skolkovo Institute of Science and Technology, Skolkovo 143025 Russian Federation, iaa.aka@gmail.com Polypedilum vanderplanki is striking example of an insect that could survive almost complete water loss. ... We used our recently developed package SAJR [2] to predict genes, perform differential gene expression (for statistical tests edgeR [3] was used) and alternative splicing analysis. ...

Еще в разделе: (Показать все результаты (>162) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/19.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/17.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/144.pdf

... Data . ... Models . ... Paraboloid model . ... SHIELDOSE is a model for space-shielding radiation dose calculations. ... Next the index of the detector type is specified, for example '1'. ... The next number indicates the nuclear interaction account, for example 1: . ... The next pair of numbers is about solar protons, the min and max energy of solar protons spectrum, default values are 0.1 and 10000 MeV. ... The next number is the number of spectrum points which divides spectrum for integration. ...

Еще в разделе: (Показать все результаты (>16) - smdc.sinp.msu.ru/ )

• NUCLEON Experiment
• COSRAD model - Space monitoring data center