Here is an example of an alignment for input for the program " Geometrical Core ". Note that the names of sequences should be of the form: . PDBcode_Chain[_Model] . 1ADR_A_2 LMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCS PDYLLKGD

Еще в разделе: (Показать все результаты (>15) - mouse.belozersky.msu.ru/ )

• Geometrical core

... CP Violation Normal mass hierarchy with m1 = 0 23 input angles CP Violation Normal mass hierarchy with m1 = 0 24 input angles CP Violation Normal mass hierarchy with m1 = 0 25 input angles CP Violation Inverted mass hierarchy with m3 = 0 blue solid lines = /2, - = 0 red dashed lines = 0, - = /4 26 insensitive to masses input angles CP Violation Nearly degenerate mass 30 QUESTION: are massive neutrinos the Majorana particles? ...

Еще в разделе: (Показать все результаты (>157) - nuclphys.sinp.msu.ru/ )

Name Last modified Size Description . Parent Directory - emx_nav_left.css.mno 30-Aug-2005 16:12 111 . Apache Server at genphys.phys.msu.su Port 80

Еще в разделе: (Показать все результаты (>19) - genphys.phys.msu.su/ )

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>46) - sn.sai.msu.ru/ )

NUMERICAL METHOD OF SOLUTION OF PROBLEM STOCHASTIC LINEAR DIFFERENCE EQUATIONS PARAMETERS IDENTIFICATION IN CASE HANDICAPES ARE AVAILABLE IN INPUT PREDICTORS Pechekhonov A.N., Kacuba O.A. (Samara) The article is touching upon the problem of numerical algorithm designing for solution of the problem of stochastic linear difference equation parameters identification on the basis of non-linear method of least squares. ... 10, 2002, .399-401 G ґ . ... V N ( ) = 0 ^ ^ (3) min ( ) ; 2). ...

Еще в разделе: (Показать все результаты (>148) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc151854/eng.pdf

Tsunami source parameters versus earthquake magnitude and depth: Monte Carlo simulation Mikhail Nosov and Anna Bolshakova M.V.Lomonosov Moscow State University, Faculty of Physics, Moscow, Russian Federation (m.a.nosov@mail.ru) European Geosciences Union General Assembly 2011 Vienna | ... Among all possible parameters of a tsunami source we consider only those parameters which can be unambiguously calculated from the vertical component of co-seismic bottom deformations. ...

Еще в разделе: (Показать все результаты (>12) - ocean.phys.msu.ru/ )

... ATOMIC COLLISIONS IN SOLIDS . ... Chapter 1. Introduction ( pdf-file ). ... Введение ( in Russian ) . ... Classical 2-body collision and kinematical relations ( pdf-file ) . ... Классическое столкновение двух тел и кинематические соотношения ( in Russian ) . ... Trajectory and cross section for two-particle collisions . ... Interaction of ions with solids . ... Determination of structure with medium- and high-energy ions . ... Surface structure determination with LEIS . ...

Еще в разделе: (Показать все результаты (>91) - danp.sinp.msu.ru/ )

... Рис. n 1 . ... Предположим, что, как и обычно, амплитуду движений по сдвигу мы определяем по плановым смещениям одновозрастных маркеров, например смещениям одновозрастных магнитных аномалий. ... Наиболее привычный случай - смещения маркеров в ? разных ? крыльях ? разлома ? по одну сторону от зоны разрастания (то есть в квадрантах 1-2 или 3-4); в свое время эти смещения дали Хессу идею крупномасштабных горизонтальных движений океанского дна. ...

Еще в разделе: (Показать все результаты (>374) - geo.web.ru/ )

• Eldfell, Heimaey, Iceland
• Письмо
• "Введение в криптографию" под редакцией В.В.Ященко - Все о Геологии (geo.web...

Boris V. Anan'ich . Notes on Boris Mironov's article "Who Paid for Industrialization? S.Witte's Economic Policies and the Well-being of the Population in 1890-1905 on the Anthropometrical Data" (Economic History. ... The usage of anthropometrical data for appraisal of economic policy of any minister raises strong doubts, particularly taking into account the fact that the article's information on Witte's reformative activity expounded in historical literature many times. ...

Еще в разделе: (Показать все результаты (>96) - hist.msu.ru/ )

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>90) - comphep.sinp.msu.ru/ )

• overview [CompHEP]
• download:rn-031116 [CompHEP]

... A new method is proposed that makes it possible to determine the parameters of the three-dimensional (3D) multiwell potential of off-center atoms from extended X-ray absorption fine-structure (EXAFS) data. ... The parameters of the multiwell potential for Ge atoms in the Sn 1-x Ge x Te solid solution as functions of temperature and composition (77<T<300 K, x>0.4) were obtained in the classical approximation. ...

Еще в разделе: (Показать все результаты (>72) - scon155.phys.msu.su/ )

• New methods of measuring photoelectric parameters of silicon

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

Еще в разделе: (Показать все результаты (>2) - saistud.sai.msu.ru/ )

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... Algorithms for calculating parameters of virtual scenes in computer vision tasks . ...

Еще в разделе: (Показать все результаты (>156) - graphics.cs.msu.ru/ )

• Videocodecs tuning | Graphics and Media Lab
• Detection of multiple object instances using Hough transform | Graphics and
• Videocodecs tuning | Лаборатория компьютерной графики и мультимедиа

... O.S.Razumovsky . ... There exist two interconnected problems in philosophy: physics and cosmology. We have essence of time, and modelling of time. ... As far as the essence of time and time modelling in physics and cosmology is concerned, we do not consider models of physical and cosmological time to be isolated from time essence. ... Here it is supposed that the existence of a ?clock? causes physiological perception of time and determines the theoretical notion ? an abstract time model. ...

Еще в разделе: (Показать все результаты (>323) - chronos.msu.ru/ )

• Laboratory-chair of Discrete mechanics on a microscopic scale
• ABSTRACTS
• Russian Interdisciplinary Temporology Seminar

.

Еще в разделе: (Показать все результаты (>16) - www.chemport.ru/ )

... Boris A. Grishanin is an Associate Professor in the Department of Physics, M.V.Lomonosov Moscow State University (MSU). He received his M.S. and Ph.D. degrees from MSU in 1963 and 1968, respectively (both in Physics). ... B. A.Grishanin's current research interests are in the field of quantum theory of open systems, laser physics, molecular dynamics of photoexcited molecules, problems of quantum information and quantum computing. ... Information theory . ... 2016 Quantum Information Laboratory. ...

Еще в разделе: (Показать все результаты (>77) - qilab.phys.msu.ru/ )

... Among the methods of theoretical investigation of coordination compounds, molecular mechanics seems to be an optimal choice. However, conventional MM force fields typically do lack metal-related force field parameters. ... Let us calculate (MM) energy gradient for experimental structures using purely organic force field with no metal-dependent terms. ... In other words, thus calculated forces give an "imprint" for the derivation of metal-dependent forces. ...

Еще в разделе: (Показать все результаты (>383) - chem.msu.ru/ )

• Comparative Analysis of Intramolecular Parameters of Nitrocompounds:
• Optimization of Optical Scheme Parameters in Dual-Beam Thermal Lens...
• Photoacoustic detection of the parameters of laser vaporisation of amorphous

... Acoustic Emission and Seismic Emission Monitoring of the Foundation of Hydroelectric Power Station Located on Soft Soils . ... If elastic waves are to be propagated in a medium with inhomogeneities (localized defects, stratification, cracks) the characteristics of the information signal, for example, velocity of propagation, amplitude, and spectral contents, can change their parameters [1]. ... These characteristics are processed with a specially developed algorithm. ...

Еще в разделе: (Показать все результаты (>173) - acs366.phys.msu.su/ )

• AUTHOR : Kazakov V
• Abstract (Invited)

Resume Analysis of localized Schmidt decomposition modes and of entanglement in problems of quantum informatics At present work a specific phenomenon of quantum state entanglement is studied by means of Schmidt decomposition. ... An algorithm based on a singular value decomposition is applied to the study of entanglement in an "atom-photon" system with spontaneous atom radiation and to a system of bi-photons with spontaneous parametric down conversion with II-nd type phase matching . ...

Еще в разделе: (Показать все результаты (>76) - ofvp.phys.msu.ru/ )

... Scientific laboratories . ... Contact information . ... oit.cmc.msu.ru . ... The Laboratory of Open Information Technologies (OIT), Faculty of Computational Mathematics and Cybernetics, Moscow State University (CMC MSU), was founded in 1998 by Professor V.A.Sukhomlin. ... Namiot Dmitry, Senior Research Fellow, PhD . ... 2013 . ... Namiot D., Schneps-Schneppe M. Smart Cities software from the developer's point of view // Applied Information and Communication Technologies (AICT 2013). ... CMC MSU ? ...

Еще в разделе: (Показать все результаты (>89) - en.cs.msu.ru/ )

• Open Laboratory of Information Technologies
• CMC MSU students at GSIS Summer School, Tohoku University, Japan | CMC MSU