1) Soil Science Faculty, Moscow State University, Moscow 119899, Russia; . ... We assessed critical loads of acid deposition and their exceedance for forest soils in the European part of the former Soviet Union using a simple balance method and mapped them within 1.0° в 0.5° longitude per latitude grid cells. ... The uncertainty in the estimated critical load values can be rather large due to uncertainty in critical chemical values for the soil as for a receptor, assessment method and data. ...

Еще в разделе: (Показать все результаты (>19) - eco.soil.msu.ru/ )

• CLEANSOIL, An innovate method for the on-site remediation of polluted soil

... Mathematical Treatment of Exhaust Systems with Acoustic Properties Using Mathlie I. Algorithms . ... The first part of the two talks is concerned with   algorithms applied to examples origin from an   exhaust system. ... The model equations are determined   by conservation of mass, momentum and energy. In addition there exists an equation of state   for the ideal gas system. ... Applying computer algebra to   these model equations, we demonstrate that   solutions can be derived. ...

Еще в разделе: (Показать все результаты (>58) - acs366.phys.msu.su/ )

... 1.2 Free-electron lasers . 1.3 Historical development of the XFEL . References . ... 2.3.5 Experience form the first user operation periods . ... 3 General layout of the XFEL Facility . ... 3.4 Beam distribution system . ... 4 XFEL ccelerator . ... 4.4.2 Space charge and coherent synchrotron radiation effects . ... 4.8.2 Layout of the XFEL synchronisation system. ... 5.1.1 Principles of XFEL operation . 5.1.2 Design criteria for the European XFEL . ... 6.1 Overview of the X-ray systems . ...

Еще в разделе: (Показать все результаты (>97) - nuclphys.sinp.msu.ru/ )

• Европейская школа по оборудованию для физики частиц и космофизики (2014)

... MBA . ... Стажировка бакалавров в Европейской школе экономики (European School of Economics) . Университет, в котором мы проходим стажировку, называется European School of Economics, основан на базе британского University of Buckhingham и имеет несколько филиалов в Италии (Милан, Лукка-Флоренция); Англии (Лондон); США (Нью-Йорк). ... Система обучения студентов European School of Economics не сильно отличается от системы и регламента обучения в ВШБ, за исключением сдачи экзаменационной сессии. ...

Еще в разделе: (Показать все результаты (>159) - www.mgubs.ru/ )

LangueDOC . ... Languages . ... Archi . ... The phonetic system of Archi is very rich, and the writing systems that are familiar to Archi speakers (Russian cyrillic and Avar cyrillic) are not sufficient for recording all sounds of the language. ... Kibrik et al. 1977] ? the notation used in this dictionary is given in the comparative table below under the label "1977"; [Kibrik, Kodzasov 1990]), but they were too difficult for the Archi speakers to learn and therefore remained inaccessible to them. ...

Еще в разделе: (Показать все результаты (>141) - www.philol.msu.ru/ )

• FDSL-7.5 | Home
• LangueDOC :: Tools :: Text conversions

... Performance System Analysis . HOPSA - the joint RF/EU project: HOlistic Performance System Analysis . ... The tool of this type is being developed in the Laboratory of Parallel Informational Technologies of Research Computing Center of Lomonosov Moscow State University. ... The HOPSA project (HOListic Performance System Analysis) therefore sets out for the first time for combined application and system tuning developing an integrated diagnostic infrastructure. ... Joint MSU-Intel Center . ...

Еще в разделе: (Показать все результаты (>18) - hpc.msu.ru/ )

... Faculty of Physics . M.V.Lomonosov Moscow State University . 7 (495) 939-16-82 info@physics.msu.ru . ... Contacts . ... Research Centers . ... Search Faculties Staff . Education . ... Research . ... Education research . ... Research Highlights of the Year . ... 15.09.2003 Dear Colleagues, I would like to recommend to your kind attention the latest issue of the Central European Journal of Physics (CEJP). ... Central European Journal of Physics . ... Faculty of Physics, 2016 . ...

Еще в разделе: (Показать все результаты (>89) - phys.msu.ru/ )

• Гумбольдтовская лекция на физфаке

... О факультете . ... Приглашаем Вас разместить свои труды в научном он-лайн журнале European Online Journal of Natural and Social Sciences , издаваемом в Чешской Республике. ... Материалы находятся в открытом доступе на сайте журнала www.european-science.com . European Online Journal of Natural and Social Sciences ? ... Редакция European Online Journal of Natural and Social Sciences . ... Д 501.001.20 - все защиты . ... Биологический факультет МГУ . ... 2016 Биологический факультет . ...

Еще в разделе: (Показать все результаты (>2) - www.bio.msu.ru/ )

. [ Войти ] . Главная -> Фильмы -> Medal of Honor: European Ass.. Пользователи . Демо . Деньги . Фильмы . Форум . Medal of Honor: European Assault . США 2005 . отметить . Приключение . Игра . Боевик . Мистика .

Еще в разделе: (Показать все результаты (>361) - kinfo.ru/ )

• Soccer Dog: European Cup - Фильмы - Kinfo.ru
• Deuce Bigalow: European Gigolo - Фильмы - Kinfo.ru
• European Vacation - Фильмы - Kinfo.ru

Astronomy Picture of the Day . ... The Helix Nebula is one of brightest and closest examples of a planetary nebula , a gas cloud created at the end of the life of a Sun-like star. ... The Helix Nebula , given a technical designation of NGC 7293 , lies about 700 light-years away towards the constellation of the Water Bearer ( Aquarius ) and spans about 2.5 light-years. ... NASA Web Site Statements, Warnings, and Disclaimers . ... Publications with keywords: NGC 7293 - Helix Nebula - planetary nebula . ...

Еще в разделе: (Показать все результаты (>5104) - www.astronet.ru/ )

• Leonids vs The Moon
• The Helix Nebula from La Silla Observatory
• Journal "Peremennye Zvezdy"

ChangeLog for snakes # # Generated by Trac 0.12.5 # 04/11/16 22:55:00 Mon, 20 Dec 2010 14:01:39 GMT Daniil Alexeyevsky me.dendik@тАж [134:8e75e931bfd2] * snakes / example.snake ( modified ) example.snake : better rules for chasing enemy tail Mon, 20 Dec 2010 11:57:44 GMT Daniil Alexeyevsky me.dendik@тАж [121:06e4b4ea7596] * snakes / example.snake ( modified ) * ...

Еще в разделе: (Показать все результаты (>383) - kodomo.cmm.msu.su/ )

• http://kodomo.cmm.msu.su/trac/snake/log/snakes?format=changelog&rev=360c297c05f3577ca730ecaf86131163456f6b73&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/snakes?format=changelog&rev=138%3A416418c9aaef&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/snakes?format=changelog&rev=416418c9aaefbd75f3451a63f12d0ab8af3b89f3&limit=100&mode=stop_on_copy

General Information . ... Symposium expenses . ... 14 European Symposium on Gas Phase Electron Diffraction . ... The Symposium is organized by the Electron Diffraction Laboratory and the Chemistry Department of the MSU. ... Gas phase molecular structures: theory and experiment . ... We would like to stimulate deeper interaction of gas phase electron diffraction with other research fields like molecular spectroscopy, solid state electron diffraction, and electronic structure theory. ...

Еще в разделе: (Показать все результаты (>15) - ged.chem.msu.ru/ )

• Abstract submission. 14 European Symposium on Gas Phase Electron Diffraction
• Accommodation and meal. 14 European Symposium on Gas Phase Electron Diffraction
• Contact information. 14 European Symposium on Gas Phase Electron Diffraction

... Screening pattern or alignment against protein databank . ... Protein databanks . SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Pattern Alignment . ... Pattern (or alignment) . Pattern example 1: . ... Alignment example: . FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...

Еще в разделе: (Показать все результаты (>135) - www.genebee.msu.ru/ )

• RNA secondary structure prediction
• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee service

... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>49) - imaging.cmc.msu.ru/ )

Thursday, June 24th, 2010 . ... Wednesday, June 16th, 2010 . На сайт добавлен пакет Lightbox 2.04 (http://www NULL .huddletogether NULL .com/projects/lightbox2/) (by Lokesh Dhakar) для отображения графики с дополнительными визуальными эффектами: . ... You are currently browsing the Лаборатория лазерной интерферометрии blog archives for June, 2010. ... Наши публикации . ... Публикации за 2011 . Публикации за 2012 . ... Лаборатория лазерной интерферометрии is proudly powered by WordPress . ...

Еще в разделе: (Показать все результаты (>4) - geo.sai.msu.ru/ )

• Lightbox 2 Лаборатория лазерной интерферометрии
• site lightbox Лаборатория лазерной интерферометрии
• Uncategorized Лаборатория лазерной интерферометрии

Date : Fri , 27 Feb 2009 01:19:03 . ... the European Week of Astronomy and Space Science which will be . ... UK).. - the Abstract and Early Registration deadline is 9th March 2009 ; . ... for those wishing to become member of the EAS/RAS and as a result . ... http://www.jenam2009.eu/ . ... Registration now open for the "European Week of Astronomy and Space Science" (JENAM2009) . ... The LOC of the "European Week of Astronomy and Space Science" . ... The "European Week of Astronomy and Space Science" . ...

Еще в разделе: (Показать все результаты (>62) - sai.msu.ru/ )

• MERAC Prizes for young European astronomers — new deadline for applications
• European Astronomical Society(EAS): NEWS
• Презентация PowerPoint

. Moscow State University . INTERNATIONAL CONFERENCE . H YDRODYNAMIC I NSTABILITY AND T URBULENCE . February 24 ? March 02 , 2008 . Moscow, Russia . Call For Papers Информационное письмо . Author instructions . Abstract example Paper example . Location (More information) . Conference Program Posters . E-mail : gertsens@imec.msu.ru . Institute of Mechanics, Lomonosov Moscow State University . Aerodynamical Installations . Moscow Sights & Attractions

Еще в разделе: (Показать все результаты (>10) - hit-conf.imec.msu.ru/ )

. ? mfs = 0.7 cm . ? hsfa = 0.8 cm . D sun_slit = F ? (2?) [rad] [cm] . (F mfs = 13500 mm, F hsfa = 35000 mm) . A procedure for calibrating fits images from Ondrejov Multichannel Flare Spectrograph .

Еще в разделе: (Показать все результаты (>154) - lnfm1.sai.msu.ru/ )

• Manpage of FITSHDR
• European Train
• IDL programs

... Hobby >> Zone >> Re: Scooter's new European tour 2010 . ... Re: Scooter's new European tour 2010 [ re: SoulTrain ] . 08.04.2010 03:27 . ... Posse (Version 2010) . ... Endless Summer (2010) / Hyper Hyper (Special Version) / Move Your Ass (2010) . ... Re: Scooter's new European tour 2010 [ re: earl_of_window ] . ...

Еще в разделе: (Показать все результаты (>2555) - www.fds-net.ru/ )

• F1 MSU. European Grand Prix. Nurburgring (Nordschleife). - Public forum of MSU
• may someone tell me how to write the following sentences in russia - Public
• Фотографии форумчан - Public forum of MSU united student networks

What would you like to search for? ... Case sensitive Match whole word Recent publications first . ... What to do if you are looking for ... words iron and oxide in the same record: iron and oxide . both these words or chemical formulae: (iron and oxide) or Fe2O3 . ... That's why do not use Co instead of cobalt : you will find Co even in al co hol! ... The hidden part of the database allows you to use full names of chemical elements instead of the short ones (like nickel instead of Ni ). ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )