... Multi-Resolution FFT: MR FFT), .. STFT : ( . ... STFT), : , »­ , (Short Time Fourier Transform: STFT) . ... This approach is able to improve quality of many audio processing algorithms (such as noise reduction) by adaptively varying STFT time-frequency resolution based on local properties of the signal: estimates of spectrogram sparsity. ... The effect of this adaptive algorithm is selection of high frequency resolution for tonal signals and selection of high time resolution for transients. ...

Еще в разделе: (Показать все результаты (>106) - imaging.cmc.msu.ru/ )

• Software projects | Laboratory of Mathematical Methods of Image Processing

... IPI program works with group of sounding curves (from 1 to 100) in one data file. ... If Type of Array is =+3 or +4, then: 7 line : Name of VES (from 1 to 8 symbols) 8 line : number of distances for this VES . 9 line : dV values (in mV or V) 10 line : I values (in mA or A) Examples of *.dtg file : Example 1 for stabilized current AMN array Bilibino-90, VES from 24.5 to 43.0. 1 2 lines - description of data profile 4 1 0 17 1 -3 S { VES number , KeyIP, ?ax.nAB, ...

Еще в разделе: (Показать все результаты (>69) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

... Mathematical models and methods in VLSI design . ... General models and statements about the complexity of combinatorial tasks, methods for development of fast algorithms (method of dynamic programming, ?divide and conquer?, ?method of model extension?) are considered. ... Mathematical models of contemporary electronic circuits are considered and basic approaches to solving task of logic synthesis, as well as tasks of VLSI modules placement and interconnection routing are described. ...

Еще в разделе: (Показать все результаты (>12) - hcs.cmc.msu.ru/ )

• Mathematical Models of Complex Systems: Theory, Algorithms, Applications |

... Key carbonatite localities that have been investigated as part of INTAS project 05-1000008-7938 ‘ Diamond and Graphite in Carbonate Magmas ’ are: (1) Western Greenland, where the distribution of kimberlites , lamproites and carbonatites is correlated with depth to a fossil subducted slab (personal communication, Nielsen 2008); (2) the Chagatai Complex of ... Generation of carbonatitic melt through partial melting of carbonated eclogite under mantle conditions. ...

Еще в разделе: (Показать все результаты (>542) - geo.web.ru/ )

• Авторский сайт Владимира Мальцева - литература
• Eldfell, Heimaey, Iceland
• Minarik: Earth Core Studies

... Publications . ... SPDC Laboratory . Quantum Electronics Chair . ... I.љB.љBobrov, E.љV.љKovlakov, A.љA.љMarkov, S.љS.љStraupe and S.љP.љKulik, . ... Laser Phys. Lett. ... JETP Letters, 99 (12), 725?730 (2014). ... I.љBogdanov, A.љA.љKalinkin, S.љP.љKulik, E.љV.љMoreva and V.љA.љShershulin, . ... M.љV.љFedorov, M.љA.љEfremov, P.љA.љVolkov, E.љV.љMoreva, S.љS.љStraupe and S.љP.љKulik, . ... I.љBogdanov, E.љV.љMoreva, G.љA.љMaslennikov, R.љF.љGaleev, S.љS.љStraupe and S.љP.љKulik, . ...

Еще в разделе: (Показать все результаты (>127) - qi.phys.msu.ru/ )

• Публикации :: Лаборатория Квантовой Информации

Current Issue About us Editors Board of Editors Guidelines Contacts . ... 2015 . ... Developing the Russian health resorts is important in restoring and maintaining people s health. The author discusses the perspectives of resorts public health care system using the experience of a specialized allergology service in a Pyatigorsk resort as an example. ... Sanatorium-resort therapy, modern sanatorium, integrated medical care, health care management, quality control, bronchial asthma, allergy . ...

Еще в разделе: (Показать все результаты (>163) - ee-journal.spa.msu.ru/ )

Unitherm for Windows (version 4.5) Contents Unitherm for Windows compared to Unitherm for DOS 2 General comments 2 Limitations of Unitherm for Windows compared to Unitherm for DOS 2 Changes in Unitherm interface 2 New functionality of Unitherm for Windows 2 Specific features of Unitherm for Windows 3 Localization 3 Graphical user interface of Unitherm for Windows 4 The main ... mode. ... The window is opened with the List of reactions command of the Unitherm Reaction menu. ...

Еще в разделе: (Показать все результаты (>70) - www.geol.msu.ru/ )

• http://www.geol.msu.ru/deps/geochems/soft/en/Main.doc
• http://www.geol.msu.ru/deps/geochems/soft/FAQ.txt
• http://www.geol.msu.ru/deps/geochems/soft/en/H2O-H2S-NaCl.doc

ISSN 0027-1349, Moscow University Physics Bulletin, 2008, Vol. ... Application of Chaotic Mapping for the Encryption of Information A. Yu. Loskutov and A. A. Churaev Department of the Physics of Polymers and Crystals, Faculty of Physics, Moscow State University, Leninskie gory, Moscow, 119992 Russia e-mail: Loskutov@chaos.phys.msu.ru Received May 30, 2007 Abstract--A new method previously proposed [1] for the encryption of information by means of chaotic mappings is studied in detail. ...

Еще в разделе: (Показать все результаты (>71) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/loskutov/PDF/JPA_destochastization.pdf
• http://chaos.phys.msu.ru/loskutov/PDF/Letter_to_editor.pdf
• http://chaos.phys.msu.ru/loskutov/PDF/Reprint_JPA_2011_44_175102.pdf

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>88) - monkey.belozersky.msu.ru/ )

• Inquiry information || Parsimony algorithm
• SDPpred
• Yeast intein-encoded LAGLIDADG homing endonucleases

Diploma thesis abstract Generation, characterization and nonlinear transformations of mid-infrared ultra-short laser pulses. ... Self-focusing-assisted self-phase modulation is determined to be responsible for generation of multi-octave supercontinuum, spanning the range of wavelengths from 3 to 18 µm. High-peak-power compressed output of a multistage midinfrared OPCPA system is employed in our experiments to enable the generation of mid-infrared laser filaments in the atmosphere. ...

Еще в разделе: (Показать все результаты (>192) - ofvp.phys.msu.ru/ )

• Laboratory of solid-state lasers and coherent spectroscopy
• Laboratory of nonlinear polarization optics
• Публикация

... The Department of Computational Technologies and Modeling was founded in 2004 and it is closely connected with the Institute of Numerical Mathematics of RAS. ... Functional analysis and computational mathematics by Prof. Bogatyrev, 68 lecture hours and 32 seminar hours, 5th and 6th semesters. ... Computational technologies and mathematical modeling of biological systems by Prof. Bocharov, 64 lecture hours, 6th semester. ... Computational information technologies of climate modeling by Prof. Lykosov....

Еще в разделе: (Показать все результаты (>128) - en.cs.msu.ru/ )

• Laboratory of Industrial Mathematics | CMC MSU
• Department of Mathematical Physics | CMC MSU
• Laboratory of Industrial Mathematics

... Academic . ... Academic Departments . ... Partners . Conferences . ... All partners . ... The international academic conference . ETHNIC PRESS GENESIS, STRUCTURE, DEVELOPMENT TRENDS . ... Conference proceedings will be published at the endљ . of the Conference as a collection of scientific articles and available in electronicљ . ... Organizing Committee address: Department of Journalism, Room 325 A, 3d floor, Main Academic Building, 42 Kulakovskogo St., Yakutsk, 677000. ...

Еще в разделе: (Показать все результаты (>51) - www.journ.msu.ru/ )

• Periodical Press :: Department of Journalism, M. V. Lomonosov Moscow State

About SPAW Editor . ... As of final version 1.0 of the control you'll need to rename the file spaw_control.default.config.php in config sub-directory to spaw_control.config.php when installing control for the first time. ... All of the SPAW Editor configuration options are located in the config/spaw_control.config.php file. ... This file will be included in img_library.php (Image library dialog script). $request_uri variable will be set to the URL of the page where SPAW Editor instance resides. ...

Еще в разделе: (Показать все результаты (>3) - textbook.sinp.msu.ru/ )

NGS Data Analysis with Unipro UGENE Olga Golosova, Yuriy Vaskin, German Grekhov, Yuliya Algaer UNIPRO, Lavrentieva ave. ... That is where Unipro UGENE NGS framework comes in play. ... Moreover, the UGENE toolkit allows one to automate common tasks by creating workflows with the integrated tools using the UGENE Workflow Designer. Analysis of NGS data with UGENE may start, for example, from quality control of raw NGS data, received from a sequencing facility, with the integrated FastQC [3] tool. ...

Еще в разделе: (Показать все результаты (>248) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/198.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/186.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/173.pdf

Using stand-alone SDPfox . ... To add a new specificity group, type in the group name and press "Add" . To change composition of specificity groups, select two groups: first, from which to remove sequences, and second, to which to add sequences. ... For a constructed grouping, it is possible to run SDPgroup, re-randomize grouping or move sequences according to the best weights (see algorithm) under the link 'SDPgroup'. ... These sequences are likely to be re-grouped after SDPgroup is performed. ...

Еще в разделе: (Показать все результаты (>137) - bioinf.fbb.msu.ru/ )

• SDPsite - Gallery of examples
• SDPsite - Algorithm Format requirements
• User's guide

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... NetCDF User's Guide for C . This appendix specifies the netCDF file format version 1. ... NC_VARIABLE nelems [var .. ... 4344 4601 0000 0000 0000 0000 0000 0000 C D F 001 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 17220 17921 00000 00000 00000 00000 00000 00000 [magic number ] [ 0 records ] [ 0 dimensions (ABSENT) ] 0000 0000 0000 0000 0000 0000 0000 0000 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 00000 00000 00000 00000 00000 00000 00000 00000 [ 0 global atts (ABSENT) ] [ 0 variables (ABSENT) ] . ...

Еще в разделе: (Показать все результаты (>54) - angel.cs.msu.su/ )

• Index
• Appendix D NetCDF 2 C Transition Guide
• Generated Documentation (Untitled)

. [ Войти ] . Главная -> Фильмы -> Evil Dead: Regeneration . Пользователи . Демо . Деньги . Фильмы . Форум . Evil Dead: Regeneration . США 2005 . отметить . Комедия . Игра . Ужасы . Боевик .

Еще в разделе: (Показать все результаты (>1142) - kinfo.ru/ )

• Generation Kill - Фильмы - Kinfo.ru
• The Doom Generation - Фильмы - Kinfo.ru
• The Guilty Generation - Фильмы - Kinfo.ru

... Why does my search timeout on the BLAST servers? Why do I get the error message "ERROR: BLASTSetUpSearch: Unable to calculate Karlin-Altschul params , check query sequence"? ... What is the Expect (E) value ? ... Certain combinations of BLAST searches with large sequences against large databases can cause the BLAST servers to timeout. ... You can use the BLAST 2.2.8 Sequences service to compare two nucleotide or two protein sequences against each other using the BLAST 2.2.8 algorithm. ...

Еще в разделе: (Показать все результаты (>224) - www.genebee.msu.ru/ )

• Genebee BLAST 2.2.22+ Services Help
• Fasta3 help
• GeneBee BLAST 2.2.22+ Services Help