I'd like to introduce a new resource for newcomers to the USA. New2USA.com is the first interactive online community serving the multicultural needs of people moving to the United States from around the globe. We guide and shape the acclimation process by integrating meaningful how-to and real-life editorial content with a host of innovative online tools and resources for the international community. ... How can you prepare to get into the graduate program of your dreams? ...
... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: taste LV, save Value: Ten, export the the . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...
... Determination of source of origin of bitumen covered on ceramics found in ancient settlement Menteshtepe, Azerbaijan . ... Biomarker analysis, hydrocarbon analysis and element content have been provided by high sensitive equipments and source of origin of bitumen has been identified. ... Moscow University Chemistry Bulletin . 2012, Vol. ... 6, P. 401 . Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ...
... The Laboratory of Programming Technologies was established in 2001. The Laboratory's team consists of collaborators and graduate students of Computer System Automation Department that work under supervision of Professor Igor Mashechkin. ... series of works for research and development of multi-functional cross-programming system. ... Presently the main scientific direction of the Laboratory is research and development of algorithms and methods for creating data mining software. ...
... About Journal | ... The Editorial team's publication decisions are made based on the data reliability and the scientific value of the work despite the race, gender, nationality, citizenship, social position, religious or political views of the Authors. ... The Reviewer performs the impartial expertise of Author's materials. ... The Reviewer must notify the editorial team on any interest conflict with the Author, with the request for excluding him from the reviewing of the given manuscript. ...
... Phase of Shock Wave Harmonics in Focused and Unfocused Ultrasonic Sound Beams . ... We present experimental results from 2 plane and 2 focusing sound sources with frequencies near 1 MHz in water. ... For plane sources: after small fluctuations within the nearfield the phase parameter flattens out at a value near -pi/2, reaching a slightly more negative value with higher source amplitudes. ... They are more sensitive to the source amplitude than with the plane sources. ...
BS - 2D data processing program. BS is a windows version of the 2D X-ray data processing program BSL in use at the Daresbury Synchrotron radiation source, for the treatment of low angle diffraction data. ... It requires less memory, has separate window to see 1D graphics and allows export of the image in two common formats: BMP and TIFF. ... information about the data file .adc . add a constant to selected range in n frames from file .add . weighted addition of two images .arg . ...
APPLICATION OF THE DIFFRACTION RADIATION INTERFEROGRAM OBTAINED AFTER THE INTERACTION OF AN ELECTRON BEAM WITH A SLIT TARGET D.A. Shkitov1), G.A. Naumenko1), M.V. Shevelev1), A.P. Potylitsyn1), H. Deng2), X. Wang 1) TPU, Tomsk, Russia 2) SINAP, Shanghai, China 2) In October 2011 a joint Russian-Chinese experiment on the extracted beam of the microtron TPU was carried out. ... Calculation taking into account the source self atten uation effect, this approach is based on the direct mathematical method. ...
... bmv : Re: Новинки программного обеспечения [re:bmv] 12.01.2009 14:48 | ... At selected airports, it is now possible to start at a predefined parking position, as an alternative to starting at the runway. ... bmv [re:bmv] 12.01.2009 15:07 | ... Units now slide between tiles while moving. ... Network/hotseat multiplayer is available, with a server to meet and other players on. ... The multiplayer server can now be logged onto using the username and password of a Wesnoth forum account. ...
... Faculty of Physics . M.V.Lomonosov Moscow State University . ... Source: Server administrator . ... September 1st, 2003, is the Day of the first-year students of Moscow State University. ... Moscow State University (Faculty of Physics) together with the Alexander von Humboldt Foundation (Germany) organizes on 26th of September, 2003, public Humboldt Lectures at Moscow State. ... Faculty of Physics, MSU, Moscow, Russia . ... Faculty of Physics, M.V.Lomonosov Moscow State University . ...
... Electronic journal Issue 4. 10 september 2004 Ulrich M. Sustainable Management of Natural Resources Introduction. ... To learn about the dynamics of natural resource management and the tragedy of the commons by means of a direct experience in the simulation game «NEW COMMONS GAME». ... 2) Tragedy of the commons and management of natural resources. ... The simulation game was followed by a short debriefing on the dynamics of the tragedy of the commons and natural resource management. ...
[
Текст
]
Ссылки http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./ulrich.pdf -- 224.7 Кб -- 06.07.2014 Похожие документы
... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...
... Data . ... Planetary perturbations during geomagnetic storms are measured by the Dst index, which is the deviation of variation of the magnetic field from the undisturbed level, averaged over the values measured at the control chain of magnetic stations located in the low latitudes. ... To predict the hourly values of the Dst index, artificial neural networks (ANN) of perceptron type are used. ... Loading of the data on the values of the Dst index and forecast update are performed twice per hour. ...
... FPGA design, architecture, means and methods of work. ... FPGA stands for Field-Programmable Gate Array, which is a semi-conductive crystal, the connections between gates of which and the logic of work can be modeled and changed repeatedly during its work. ... Each semester has 12 obligatory classes of four (4) academic hours each once a week, which totals in 48 hours per semester. ... In spring semester students have 44 hours to work on their term papers on design and then 4 hours for defending...
... О кафедре . English . ... Department for Jewish Studies of Lomonosov Moscow State University . ... The Department for Jewish Studies (DJS) was established in 1998. ... The students take courses offered by the School (the Institute of Asian and African Studies), as well as courses offered by the Jewish Studies Department. ... The Department regularly accepts university teachers of Jewish and Israeli Studies from Russia and the FSU in order to upgrade their professional level. ...
Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...
[
Текст
]
Ссылки http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/237.pdf -- 74.5 Кб -- 04.06.2013 Похожие документы
AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...
... Finance for Start-Up . ... Инновационная . структура МГУ . ... Обучение инновационному менеджменту . ... деятельности . ... Process of Forming a Company . ... Typical business development & equity scenario . ... Unfortunately, there is no single type of financing appropriate for all start-up companies and no single path to accessing money. ... 2005 Управление инновационной политики . и организации инновационной деятельности . МГУ им. М.В. Ломоносова . ...
... Number of required sensors is 10000 4 The part of ANTARES collaboration (http://antares.in2p3.fr/Collaboration/index.html) 5 The some direction of MSU group activity in the project · Bioluminescence cut · Quality cuts · SN search 6 Bioluminescence cut We have collected distributions of hit counts for each PMT during one K40 run (~45min) Usually these distributions consist of 2 parts Poissonian (due to K40 and plankton ... Conclusion Bioluminescence cut was done. ...
[
Текст
]
Ссылки http://antares.sinp.msu.ru/docs/Shirokov%20-%20The%20first%20results%20of%20MSU%20groups%20in%20ANTARES%20project.pdf -- 643.2 Кб -- 16.12.2013 Похожие документы