... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>62) - imaging.cmc.msu.ru/ )

... You have to choose only one answer among the suggested options; for tasks 1-4 write down `agree' beside the answer you choose. ... Peptide bond between amino acids in a molecule of protein is underlaid by: a) b) c) d) the principle of complementarity; insolubility of amino ac ids in water; solubility of amino acids in water; the presence of carboxy and amino group; Task 2. ... There are ten cards, each with one side white and one side black. ... What is your understanding of the word "progress"? ...

Еще в разделе: (Показать все результаты (>141) - www.psy.msu.ru/ )

Using GibbsLib.dll in user's applications Contents Introduction 2 Creating and deleting the object Gibbs 2 Gibbs object properties 3 Common Gibbs properties 3 Special Gibbs properties 4 Gibbs object methods 6 Common Gibbs methods 6 CallGibbs 6 ReCallGibbs 7 SetFugacities 8 CancelGibbs 9 ShutDown 9 Special ... mode option) of i-th species: | ... If used, this property must be set before SystemFile, as some options affect the way System files are read (see "Gibbs options" below). ...

Еще в разделе: (Показать все результаты (>44) - www.geol.msu.ru/ )

• http://www.geol.msu.ru/deps/geochems/soft/en/Ab_An.doc
• http://www.geol.msu.ru/deps/geochems/soft/en/Electrum.doc
• http://www.geol.msu.ru/deps/geochems/soft/en/Unitherm.doc

Prague, August 16, 2006 . Our trial revision of the GCVS data for several southern constellations show that type changes are not needed for most stars. ... We suggest to add one more symbol combining types, in the cases when two or more classification options remain for the same star, for example, EC|Ell, EC|RR (here EC means a contact eclipsing binary, this is one of our suggestions from next slides). ... Moreover, it will simplify moving stars from the suspected-variable catalogue to the GCVS. ...

Еще в разделе: (Показать все результаты (>68) - sai.msu.ru/ )

Submission Instructions Please read all instructions before completing the form. ... Name: | ... Name Phone | ... No Yes |( ... Are written and dated laboratory records and data available? ... Please provide date of defence or anticipated date of defence. ... Was the invention created using confidential information of a third party? ... result in similar information no longer being supplied to the University when | ... Inventor's signature(s) (if selecting option A, | ... Print Name Signature | ...

Еще в разделе: (Показать все результаты (>35) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/russian/settingupapaysystem_rus.pdf
• http://www.innovation.msu.ru/russian/guidetomarketresearch_rus.pdf
• http://www.innovation.msu.ru/russian/marketingplanoutline_rus.pdf

... For impatient users: You can download RusTeX in three different ways (Full installation; Selective download; Diskette-ready minimal installation) --- so at least read explanations about these methods before you download something. Please, use "Save link as" (right mouse button) for downloading files, otherwise .arj files and other binary files will be corrupted. ... TeX files are compact and readable in any text viewer: just text and commands for formatting and commands for equations drawing. ...

Еще в разделе: (Показать все результаты (>9) - tex.bog.msu.ru/ )

• http://tex.bog.msu.ru/

Prediction of physical properties of materials based only on their chemical composition has long been an intriguing task. ... The main interests of Prof. Lebedev 's group are physical properties of crystals exhibiting structural instability, in which different phase transitions (including the ferroelectric one) can appear. ... A.I. Lebedev. ... Physics of the Solid State 51 , 362 (2009) ; e-print arXiv:1305.0240 (2013) ; [local copy] . ... Physics of the Solid State 51 , 2324 (2009) ; [local copy] . ...

Еще в разделе: (Показать все результаты (>49) - scon155.phys.msu.su/ )

... All circuit parameters have been presented in a symbolic form. ... To use the program you will need a CIR file (PSpise, DesignLab file) of your circuit. CIR file examples have been enclosured: bpasside.cir, test1.cir, test2.cir, test3.cir, test4.cir, laksamp.cir, bridge.cir, uA741acf.cir, quartz.cir. ... Ideal operational amplifier (nullor) * Nname n1 n2 n3 n4 * * In the ideal op amp data, (n1,n2) represent output nodes, * (n3,n4) represent input nodes (noninverting, inverting). ...

Еще в разделе: (Показать все результаты (>10) - astrometric.sai.msu.ru/ )

• Complex evaluator
• Symbolic matrix processor

... X-Com key features (2) · Lightweight portable toolkit: ­ easy to install · Perl-based software · doesn't need administrator/root access ... must be written ­ simultaneous work of different platforms · joining Windows and Linux machines ­ distributed freely · BSD license X-Com basic requirements · Linux / Windows · Perl 5.8.0+ ­ for Windows: · Strawberry Perl (preferred) · ActivePerl · Open TCP port for Task initializing on server side Server part of the application 2. ... Portion request 6. ...

Еще в разделе: (Показать все результаты (>32) - hpc.msu.ru/ )

• http://hpc.msu.ru/files/HPC/X-Com_tutorial.pdf

... О Школе . ... Магистерская программа Высшей школы бизнеса МГУ получила международную аккредитацию ABEST21 . ... В 2015 году Высшая школа бизнеса МГУ подтвердила статус одной из ста лучших бизнес-школ мира и получила награду высшей категории как 'бизнес-школа, имеющая наивысшее международное влияние'. 21.10.2015 . ... Декан Высшей школы бизнеса МГУ О.С. Виханский получил награду от Международной ассоциации бизнес-образования ABEST21 за 10-летний вклад в работу ассоциации в качестве ее Вице-президента...

Еще в разделе: (Показать все результаты (>4425) - www.mgubs.ru/ )

• Варшавская школа экономики

... Мудрый подход при выборе источника энергии . ... This script was written by Vijay Cuddeford, researcher/writer at Developing Countries Farm Radio Network. ... Appropriate technology part 8: Biomass energy", Outreach No. 81, 1992, 40 pages. Outreach, PO Box 30552, Nairobi, Kenya. Appropriate technology part 7: Solar energy", Outreach No.80, 1992, 44 pages. ... 102C, 1997, 66 pages. ... Quelles solutions 'nerg'tiques pour les pays du Sahel?" Taoufik Budchiche, Echo du Sahel, Volume 1, No. ...

Еще в разделе: (Показать все результаты (>139) - www.fadr.msu.ru/ )

• Package 49, Script 7
• Package 49, script 10
• Package 42, script 1

... Reports on progress and error are always recorded in the log file of the program. ... UT date of the measurement finish in YYYY-MM-DD format UT time of the measurement finish in hh:mm:ss format Average flux in A aperture Average flux in B aperture Average flux in C aperture Average flux in D aperture Normalized variance of flux in A aperture Normalized variance of flux in B aperture Normalized variance of flux in C aperture Normalized variance of flux in D ...

Еще в разделе: (Показать все результаты (>22) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/new_details_v2.pdf
• http://curl.sai.msu.ru/mass/download/doc/sv_ug.pdf
• http://curl.sai.msu.ru/mass/download/doc/new_details.pdf

... MSU Web Sites . ... General Information . ... The MSU School of Television Board of Regents consists of Oleg Dobrodeev, head of the VGTRK; Anatoly Iksanov, Director General of the Bolshoi Theatre; Anatoly Lysenko, president of the Russian Academy of Television and Radio Broadcasting; Vladimir Mamontov, Editor-in-Chief of the Izvestiya newspaper; Alexander Ponomaryov, Director General of the television channel TV-Centre; Viktor Fyodorov, Director General of the Russian State ...

Еще в разделе: (Показать все результаты (>52) - www.msu.ru/ )

• The scheme of an arrangement of MSU buildings on Leninskiye Gory

... Полная версия этой страницы: Какой фильм вы посмотрели вчера/сегодня? Студенческий форум Физфака МГУ > Общий > Все обо всем > Кино, музыка, литература . ... Я поменял свое отношение к индийскому кинематографу, когда посмотрел . ... мультфильм посмотрел.. ... cheap uggs Finding best of the best affiliate script too all your family means knowing all of which affiliate piece of software not only ...

Еще в разделе: (Показать все результаты (>805) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Funny Shit
• Студенческий форум Физфака МГУ > Каррент мьюзик
• Студенческий форум Физфака МГУ > Opera vs FireFox

... Географии мирового хозяйства . Геохимии ландшафтов и географии почв . Гидрологии суши . ... Рекреационной географии и туризма . Социально-экономической географии зарубежных стран . Физической географии и ландшафтоведения . ... Выберите кафедру . ... Ученый совет . ... Кафедры . ... География" . ... Образование . ... Научно-методический совет по экологии Министерства образования и науки РФ . ... Кафедра гидрологии . ... Просмотров: 176 Тема: pslnl в форуме: Кафедра гидрологии . ...

Еще в разделе: (Показать все результаты (>208) - www.geogr.msu.ru/ )

• Получение снимков Terra по Интернет
• Instructions for Authors, contributing to “GEOGRAPHY, ENVIRONMENT,
• wnsvnttw iybtwjfpGS (все сообщения)

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

Poligraphic complex (printing plant) - humanitarian aid from RRU to South Ossetia A.A. Tibilov State University The printing plant is intended to make a wide range of materials - textbooks, manuals, presentations, reports, informational and commercial printed matters. ... wide color range, surpassing that of offset printing; . ... simple operation and high reliability. [pic] Besides the printer, there is a digital color copier Duplo DPS850 (Japan) size A3, in the printing complex. ...

Еще в разделе: (Показать все результаты (>30) - www.rsr-online.ru/ )

... Complete proteomes were extracted from these genomes and domain architectures were assigned to each protein using the Pfam domain database [6] and the COGs database [5]. ... PF02874 (CL0275) ATP-synt_ab_N (ATP synthase alpha/beta family, beta-barrel domain) PF00006 (CL0023) ATP-synt_ab (ATP synthase alpha/beta family, nucleotide-binding domain) PF00306 (\N) PF00231 (\N) PF00119 (\N) PF00137 (\N) ATP-synt_ab_C (ATP synthase alpha/beta chain, C terminal domain) ATP-synt (ATP synthase) Figure 1. ...

Еще в разделе: (Показать все результаты (>162) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/134.pdf
• MCCMB'13

... Чтобы сделать nature.web.ru своей стартовой страницей: . ... В меню View (Вид) выберите Internet Options (Свойства обозревателя). В разделе Home page (Домашняя страница) введите http://nature.web.ru в поле Address (Адрес). Нажмите кнопку OK. для Internet Explorer 3.0 . ... В поле Page выберите Start Page. ... Нажмите кнопку OK. Затем нажмите кнопку Home на панели инструментов. для Netscape Communicator . ... В поле формы ниже Home Page Location введите http://nature.web.ru . ...

Еще в разделе: (Показать все результаты (>125) - www.nature.web.ru/ )

A Short Course in Differential Geometry and Topology A.T. Fomenko and A.S. Mishchenko sP A Short Course in Differential Geometry and Topology A.T . ... Partition of Unity 2.4.1 Functional separability 2.4.2 Partition of unity 3 CONTENTS 51 52 54 Smoot h Manifolds (General Theory ) 57 3.1 Concept of a Manifold 59 3.1.1 Main definitions 59 3.1.2 Functions of change of coordinates. ... Frenet formulae 4.1.2 Theory of spatial curves. ... Examples and illustrations are included throughout the chapter. ...

Еще в разделе: (Показать все результаты (>128) - higeom.math.msu.su/ )