... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...

Еще в разделе: (Показать все результаты (>2) - oc.cs.msu.ru/ )

... While assessing the effects of vegetation burning on soil properties, Mills Fey (2004) proposed the term pedoderm to describe those first few centimetres of soil in which certain properties are often expressed much more strongly than in the remainder of the soil surface horizon. ... The pedoderm hosts or serves as substrate for the formation of both biological and physical crusts of the kind described, respectively, by Belnap and Lange (2003) and Singer and Shainberg (2004). ... 2003; Cadenasso et...

Еще в разделе: (Показать все результаты (>148) - www.fadr.msu.ru/ )

• INQUA/ISSS PALEOPEDOLOGY COMMISSION NEWSLETTER
• The Period 1995 - 1999 of the Paleopedology Commission

THE PARAMETERS INVOLVED IN HAPKE'S MODEL FOR ESTIMATION OF THE COMPOSITION OF THE EJECTA LUNAR TERRAINS. ... In the previous papers we were estimated the surface roughness of the ejecta lunar terrains by means comparison of the local phase function and the average integrated lunar indicatrix. ... The Hapke's theoretical model of the lunar surface reflection. ... For THE PARAMETERS INVOLVED IN HAPKE'S MODEL: S.G. Pugacheva, V.V. Shevchenko a low-albedo lunar surface parameter Bo = 1. ...

Еще в разделе: (Показать все результаты (>84) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Chik/Publications/ms42/m42_12.pdf

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>24) - cdfe.sinp.msu.ru/ )

• CDFE provides the major photonuclear databases. Online Services.
• CDFE => Online Services => Nucleus Ground State Parameters
• CDFE - Centre for Photonuclear Experiments Data - Home page

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2002_1.pdf

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... It is naturally to treat the change-points appearing close in time in a number of EEG channels as a single complex. We will call it a change-point synchrocomplex , or simply synchrocomplex . ... The spatial configuration of the functionally connected areas may vary dramatically within even short time intervals, and this dynamics may manifest itself in change-point synchrocomplexes. ...

Еще в разделе: (Показать все результаты (>59) - brain.bio.msu.ru/ )

• Change-point synchronization between signals or signal components
• Change-points in EEG components with different pattern
• Change-points in multi-channel EEG

Euro-Asian Astronomical Society . The International Astronomy Olympiad . ... On the basis of the present Founding Statutes the Coordinating Council of the International Astronomy Olympiad elaborated and if necessary replenishes the "Acting Statutes/Regulations on International Astronomy Olympiad of School Children" which are approved at the meeting of authorized representatives from the founding organizations and participating states held every year during the Olympic period . ...

Еще в разделе: (Показать все результаты (>10) - www.issp.ac.ru/ )

fitshdr - FITS-file headers manipulation tool fitshdr [options] [FITSfile_name] . ... fitshdr [options] --edit FITSfile_name . ... If You want to modify headers of FITSFILE using new FITS-header lines from HEADER file (or from stdin), You have to use this option (You can skip this option, if -H or --header option is used). ... Empty header lines are not displayed (in 'dump' mode only). --line-offsets . ... In 'dump' mode: file offset will be displayed for each header line. --no-line-offsets . ...

Еще в разделе: (Показать все результаты (>166) - lnfm1.sai.msu.ru/ )

• Астрономическое отделение Физического факультета МГУ им.Ломоносова - Кафедры
• Proposing a METI Institute

Fast evolution of a conserved residue of polyomaviruses defines a new mechanism of adaptation that operates by accelerated codon-constrained Val-Ala ( COCO-VA ) toggling within an intrinsically disordered protein region Chris Lauber1,2, Siamaque Kazem1, Alexander A. Kravchenko3+, Els van der Meijden1, Sander Kooijman1, Mariet C.W. Feltkamp1, and Alexander E. Gorbalenya1,3,4* 1 Department of Medical Microbiology, Leiden University ...

Еще в разделе: (Показать все результаты (>231) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/55.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/49.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/134.pdf

... Please retype /font /b /td /tr % } tr td class = form nbsp; b Your name: /b /td td class =formi input type=text size= 60 value= %$ author % name= author /td /tr tr td class = form nbsp; b Your e-Mail: /b /td td class =formi input type=text size= 60 value= %$ dbh->quote($author) . ... br>"); return -1; } my $last_id=DB_functions::get_max_id($dbh,$tree,'id'); my $parent = ($id>0)?$id:0; if (!$dbh->do("INSERT INTO $tree (id,parent,resource) VALUES ( $last_id," . ...

Еще в разделе: (Показать все результаты (>64) - www.kosmofizika.ru/ )

• http://www.kosmofizika.ru/includes/forum/showmessage.msn

FAQ: QUESTIONS ASKED BY NOVICE USERS (c) Australian Geological Survey Organisation 1999-2002 (c) Yuri Shvarov 1999-2002 Last updated: 3 May 2002 This file does not substitute for the comprehensive HCh documentation. ... 2 UNITHERM USAGE 2.1 UNITHERM DATABASE 2.1.1 What is the guaranty that the included UNITHERM database has no incorrect entries? ... User's Guide. ... You can speed up your calculations for aqueous systems in a "manual" calculation mode of GIBBS when using Blank or Input files. ...

Еще в разделе: (Показать все результаты (>48) - www.geol.msu.ru/ )

• http://www.geol.msu.ru/deps/geochems/soft/en/GibbsLib.doc
• http://www.geol.msu.ru/deps/geochems/soft/en/GibbsExt.doc
• http://www.geol.msu.ru/deps/geochems/soft/Guide_34.txt

... Простейший прием защиты информации: выдача страниц по паролю*** --- Загрузка JavaScript из внешнего файла Функции function (arg) {...} и событие body onload= func(); } --- Типы событий: onclick, onmouseover, onmouseout --- Вызов функции из функции --- Аргументы функции --- Возвращаемое значение return(), calc3(calc2(calc1(arg))) Формы --- Простые формы (сначала без атрибутов) --- Варианты input (должны иметь value , ...

Еще в разделе: (Показать все результаты (>188) - herba.msu.ru/ )

• Systema Naturae
• Algae as indicators of enviromental quality

... The first line of each paragraph should be indented by 0.63 cm except for paragraphs that follow a white space (e.g., after a heading, example, table or figure). ... References to examples in the text should take the form "see (1a) and (1b)" with both number and letter in brackets. ... 2.6 Pagination There should be no orphaned example numbers, that is, example numbers with corresponding text on the following page; page breaks in definitions or between examples and glosses, etc. ...

Еще в разделе: (Показать все результаты (>272) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/fdsl/FDSL7.5-stylesheet.doc
• Speech rhythm in diachrony and synchrony
• LangueDOC :: Tools :: Text conversions

The quantitative probabilistic model of the solar energetic particle fluxes description . ... Notice : Undefined index : ion_spectra in / home / swx / public_html / models / database / modules / prog.php on line 152 Notice : Undefined index : MNX in / home / swx / public_html / models / database / modules / prog.php on line 153 Notice : Undefined index : NPB in / home / swx / public_html / models / database / modules / prog.php on ...

Еще в разделе: (Показать все результаты (>13) - swx.sinp.msu.ru/ )

• http://swx.sinp.msu.ru/models/database/modules/prog2.php
• http://swx.sinp.msu.ru/models/database/modules/smdc-prog.php
• http://swx.sinp.msu.ru/models/ch_area.php

... Formulation of the problem ­ angle about the mass center C IC = mR 2 ­ central moment of inertia m and R ­ mass and radius of the hula-hoop k ­ coefficient of viscous friction r ­ radius of the waist FT ­ friction force N ­ reaction force ­ angle between x and CO x = a sin t , IC m m Ё +k (R - (R - y = b cos t = -FT R r ) = m (x sin + y cos ) + FT Ё Ё Ё r ) 2 = m (x cos - y sin ) + N Ё Ё (R - r ) = R ­ non-slippage where constants 0 mod 2 are defined from + µ cos 0 = 0. ...

Еще в разделе: (Показать все результаты (>9) - belyakov.imec.msu.ru/ )

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>159) - www.pereplet.ru/ )

... About 70 scientific papers. The theory of square parachute is created, describing distribution of parameters of shape, tension and resistance to airflow of canopy in steady-state condition for various sets of suspension line lengths and air-permeability. ... The practical recommendations for optimal parachute application are submitted. ... It is discovered experimentally that a character of pressure distribution for a square canopy depends on a particular choice of suspension line lengths. ...

Еще в разделе: (Показать все результаты (>7) - margaret.imec.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... email: npavluk@mail.ru) , , , -, public relations, Culture, subculture, Business community , , . The article presents an analysis of public relations social institution in the contemporary cultural context characterized by the wealth of intercultural communication, styles and subculture types. Business community is defined by the authors as an integral socially-cultural group with its inherent subculture. ...

Еще в разделе: (Показать все результаты (>32) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2010/3/08.pdf
• http://www.socio.msu.ru/vestnik/archive/2010/3/21.pdf
• http://www.socio.msu.ru/vestnik/archive/2011/3/10.pdf

Your Marketing Strategy Canada Business Service Centres - CBSCs 1. ... List your service(s) or product(s) . ... Personal Selling o Evaluate Media, Vehicles (Strengths/Weaknesses) o Target Market Analysis o Cost Advertising o Which media best reaches your customers? o When should you advertise? o How much should you spend? o How often should you advertise? o What should you advertise? o Cost/Benefit analysis Sales Promotion o What type of sales promotion should you do? o What form should it take? ...

Еще в разделе: (Показать все результаты (>15) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/english/marketingplanoutline.doc