INTERNATIONAL HUMIC SUBSTANCES SOCIETY . COMMONWEALTH OF INDEPENDENT STATES (CIS) CHAPTER . Regional Chapter of the Commonwealth of Independent States (CIS-IHSS) . It is our pleasure to inform the Society about the decision of the scientists and engineers from Russia and the other countries of the Commonwealth of Independent States (CIS) to join their efforts in fostering humic substances research in the framework of the newly born Regional Chapter - CIS IHSS. ...

Еще в разделе: (Показать все результаты (>93) - mgumus.chem.msu.ru/ )

• MGUMUS -- First International Conference on Humics-based Innovative
• MGUMUS Home Page
• MGUMUS -- Second International Conference of CIS IHSS on Humic Innovative

... The single password sign will be replaced by the more superior two factor authentication as it is becoming increasingly easy to crack a four or five character password within a few minutes using password cracking tools. ... The tool cracks any password of up to seven alphanumeric characters (lower and upper case) in a matter of seconds, with a 99.97% success probability. ... ray ban outlet uk . ... http://projahn.by/cheap-ray-bans-internet-professionals . ...

Еще в разделе: (Показать все результаты (>132) - elana.sinp.msu.ru/ )

• Burberry outlet stores come having a pleasant decision concerning anything
• editor | С Днем Победы!
• An outside wedding will be difficult for older relatives and for the people

VISA SUPPORT FORM |Family name| ... Date of | birth | __________________________________ If there is the second (or moreover) citizenship they are specified through a point State of birth ____________________ place of birth _______________________________________ country exact place of birth State of inhabitancy _________________ region___________________________________________ country region in the state of inhabitancy The closest Russian Consulate where you will ask for visa: ...

Еще в разделе: (Показать все результаты (>26) - foroff.phys.msu.ru/ )

• Seminar in SRCC

... M. V. Lomonosov Moscow State University . ... M.V.Lomonosov Moscow State University, Moscow, Russian Federation . ... PhD at the Department of Electrochemistry, M.V.Lomonosov Moscow State University . ... S.Trasatti, O.A.Petrii, "Real surface area measurements in electrochemistry" J.Electroanal. ... O.A.Petrii, S.Ya. ... O.A.Petrii, G.A.Tsirlina, T.V.Rakova, S.Yu.Vassiliev, "Anomalous features of thallium oxide electrodeposited layers and room temperature HTSC electrosynthesis", J.Appl. ...

Еще в разделе: (Показать все результаты (>11) - www.elch.chem.msu.ru/ )

• Molecular aspects of solid state and interfacial electrochemistry
• Laboratory of Electrochemical energetics
• Galina A. Tsirlina

... Et maintenant qu'il faut partir, On a cent mille choses Ю dire, Qui tiennent trop Ю coeur pour si peu de temps., On s'est aimИ comme on se quitte, Tout simplement sans penser Ю demain, A demain qui vient toujours un peu trop vite, Aux adieux qui quelque fois se passent un peu trop bien. ... Allons petite il faut partir, Laisser ici nos souvenirs, On va descendre ensemble si tu veux, Et quand elle va nous voir passer, La patronne du cafИ, Va encore nous dire "Salut les amoureux". ...

Еще в разделе: (Показать все результаты (>9) - optics.sinp.msu.ru/ )

... They elected her to represent them on the committee. 4.to lose elections ґ to receive an amount of money paid by government or company, to someone who can no longer earn money by working. ... The government must introduce new tough policies to reduce unemployment. 8.to give glimpses ґ a person who travels from place to place and holds religious meetings in the open air to persuade people to become Christians. ... Most students have to stretch their money while studying away from home. ...

Еще в разделе: (Показать все результаты (>20) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/last_year_theses_by_A_Rakitko.pdf

... Home News Program Committee Organizing Committee Program Plenaries Special Sessions Registration Abstracts Accommodation Important dates Contacts Poster Links Conference Venue Video . Conference Venue . Conference Opening ceremony will take place on Tuesday, June 17 at 13:00 in the MSU Library Building . ... On other conference days registration will be possible in the room 706 of the 2-nd Educational Building. ...

Еще в разделе: (Показать все результаты (>7) - pont2008.cmc.msu.ru/ )

... Next: Restarting scanning process Up: Surface scanning Previous: Changing the size of Contents Index . To move scanning window in a different place on the studied surface, select Scan/ Offset menu command or press button and select Offset command. Then mouse pointer change its appearance to aim-like. ... At the same time values in the Parameters window will change. ... Next: Restarting scanning process Up: Surface scanning Previous: Changing the size of Contents Index Filonov 2005-02-04 ...

Еще в разделе: (Показать все результаты (>70) - www.spm.genebee.msu.ru/ )

• Files Quick Viewing
• Scanners
• Bagrov Dmitry

CONDOLENCES on occasion of Moscow and all-Russia Holy Patriarch's alexi II decease December 5, 2008 A great grief has befallen upon us - pontiff of Russian Land has passed away. He was a great Person and Teacher, who for decades was the spiritual core of Russian Orthodox Church, Russian State and all Russian people. One's mind cannot comprehend and words cannot express the imperishable sorrow, for His Holiness' life was a part of life, soul and heart of every human being. ...

Еще в разделе: (Показать все результаты (>33) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/242.doc
• http://www.rsr-online.ru/doc/2012_09_24/2.pdf
• http://www.rsr-online.ru/doc/norm/461.pdf

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>90) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• MUSCLE 3.6
• Picornaviruses: discovering big in small

... De winnaar van de DABIDA Hannie Sarris Award 2011 is geworden . Victoria Minenko uit de OekraОne . The winner of the DABIDA Hannie Sarris Award 2011 is . Victoria Minenko from the Ukraine . Victoria Minenko: Ukraine . De tweede prijswinnaar is geworden . Yulia Litvinova uit Rusland . Second place is for Yulia Litvinova from Russia . Yulia Litvinova : Russia . ... Nefer Kane uit Frankrijk . Third place is for Nefer Kane from France . Nefer Kane: France . ...

Еще в разделе: (Показать все результаты (>302) - chronos.msu.ru/ )

• Historical events as manifestations of time
• Computers without Clocks
• Ethan Frome

University Satellites and Space Science Education" (Moscow, June 26-30, 2006). Brief report about the conference UNIVERSAUT-2006, which took place in Moscow, on June 26-30, 2006. Space and Education", Ulyanovsk, Octover 10-14, 2005. Photo-report about the school-seminar "Space and Education", which took place in Ulyanovsk, on October 10-14, 2005. ...

Еще в разделе: (Показать все результаты (>64) - cosmos.msu.ru/ )

• UNIVERSAT-2009: University Satellites in Space Sciences Education, Zvenigorod,
• University Satellites and Space Science Education '2006

... Science Festival will take place in Moscow on October 10-12 2014. Engineering Physics Laboratory will participate in the IX Science Fectival. During the Science Festival many events will take place: lectures by Nobel Laureates, lectures by eminent scientists and popularizers of science, meeting with astronaut, demonstration of the latest scientific developments and inventions. Engineering Physics Laboratory will show main projects and tell you about achievements. ...

Еще в разделе: (Показать все результаты (>79) - engineering.phys.msu.ru/ )

• Participation in IX Science Festival
• Science Festival 2015
• Meeting with the representatives of Russian Universities

... Математический семинар Глобус, заседание 21 декабря 2006 г. В четверг, 21 декабря 2006 года, в 15:40 в конференц-зале НМУ, Б. Власьевский 11, состоится доклад: Topics in max-plus or tropical spectral theory. ... One of the main motivations of max-plus spectral theory is the classical spectral theory, since the max-plus eigenproblem can be obtained as the limit of a deformation of the classical eigenproblem. ... I will discuss max-plus spectral problems over a non-compact spate space. ...

Еще в разделе: (Показать все результаты (>367) - www.mmonline.ru/ )

• Конференция Geometry and Integrability in Mathematical Physics
• MMOnline | Форумы | Разное | Трансляция лекции лауреатов Тьюринговской премии
• MMOnline | Форумы | Обсуждение сайта | typo in form.php3

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . The GDE alignment format is one of the standard alignment formats. Popular programs for sequence alignment, e.g. ClustalW, can save alignment in this format. ... Sequences are placed one after another, the name of each sequence is placed onto a separate line and begins with ?%?. ... Thus the alignment looks like this: . ... back to input format rules . ...

Еще в разделе: (Показать все результаты (>42) - monkey.belozersky.msu.ru/ )

• S people

Конференция выпускников Химфака МГУ, . работающих за рубежом . ... Дата рождения (день, месяц, год) . Date of birth (day, month, year) . ... Государство рождения . State of birth . ... Точное место рождения . Exact place of birth . ... Адрес места работы: Полный адрес организации, фирмы . ... A copy of your passport with the following data: Name and surname,Date of birth, Sex, Citizenship, Passport number, Date of issue, Expiration date . ... Dates and duration of planned stay . ...

Еще в разделе: (Показать все результаты (>79) - www.chem.msu.ru/ )

• Immortals of science: Mendeleev

... PhD student, Physics Department, M.V.Lomonosov Moscow State University . ... International Laser Center and Faculty of Physics . M.V.Lomonosov Moscow State University . Moscow 119899 . ... 2016 Quantum Information Laboratory. ...

Еще в разделе: (Показать все результаты (>92) - qilab.phys.msu.ru/ )

... Director of the Institute of World Culture . Member of Russian Academy of Sciences . ... Moscow State Lomonosov University (MGU); Institute of Slavic Studies of the Russian Academy of Sciences; Russian State Humanities University (RGGU); University of California, Los Angeles (UCLA), Department of Slavic Languages and Literatures and Indo-European Studies Program. ... Director of the Research Institute of World Culture of the Moscow Lomonosov State University (MGU), 1989-present. ...

Еще в разделе: (Показать все результаты (>17) - imk.msu.ru/ )

Alkaline plume-magmatism of continents and oceans and roots of alkaline plumes . ... In the oceans alkaline magmatism is developed weakly, as compared to continental crust, and the mere series of oceanic alkaline formations seems to be clearly contracted, shortcut. There, the signs of plumes with high alkalinity can be observed, in first turn, on islands located in continent-ocean transition zones near passive Atlantic type margins. ... rhyolite (alkali-rhyolite) ? trachyte ? alkali-basaltic . ...

Еще в разделе: (Показать все результаты (>441) - geo.web.ru/ )

• Представление специалиста
• Dictionary_P
• Informal geological society (RSG SG )

Basic information for foreign applicants to the . Department of Chemistry, Lomonosov Moscow State University . ... The applicant should mention: . ... To sign a contract for studies at the Moscow University, an applicant should send the set of documents. ... Department of Chemistry . Lomonosov Moscow State University . ... Special Program developed for chemistry entrance examinations in Moscow State University . ... Copyright (C) Chemisty Department of Moscow State University . ...

Еще в разделе: (Показать все результаты (>265) - chem.msu.ru/ )

• Social Programme. Russian XV International conference on chemical...
• Moscow University Chemistry Bulletin Vol. 49, No. 2, P. 102 (2008)
• Moscow University Chemistry Bulletin Vol. 50, No. 1, P. 35 (2009)