... The Department of Operations Research . April 9, 2016 . Welcome Traditional topics of the conference Important dates Abstracts Registration . Final program Accommodation Program committee Organizing committee . ... V Moscow International Conference . on Operations Research, . ... Moscow, April 10-14, 2007 Important dates . ... Abstract deadline: December 20, 2006 . New deadline: January 10, 2007 . Notification of submission: February 1, 2007 . Create Date : 23.05.05 . ...

Еще в разделе: (Показать все результаты (>12) - io.cs.msu.ru/ )

• Coordinators - ORM 2007
• Traditional topics of the conference - ORM 2007
• Abstracts - ORM 2007

... Study of the nature and magnitude of buffer capacity in various soils, information on mechanisms of buffer reactions is required to predict the rates of further acidification and to estimate the critical loads. ... The problem of estimation of soil sustainability to acid deposition is considered. ... The uncertainty in the estimated critical load values can be rather large due to uncertainty in critical chemical values for the soil as for a receptor, assessment method and data. ...

Еще в разделе: (Показать все результаты (>27) - eco.soil.msu.ru/ )

• MULTIVARIATE ANALYSIS OF SOIL CHEMICAL PROPERTIES
• Forest ecosystem data in Norwegian-Russian border area

... 9, 139 ґ 140 (2009) / DOI 10.1002/pamm.200910044 New cases of integrability in dynamics of a rigid body with the cone form of its shape interacting with a medium Maxim V. Shamolin 1 1 Institute Of Mechanics, Lomonosov Moscow State University, Michurinskii pr., ... We use the properties of body's motion in a medium under conditions of the jet flow past this body. ... The new families of phase portraits of variable dissipation systems are obtained, their absolute or relative roughness is demonstrated....

Еще в разделе: (Показать все результаты (>40) - shamolin2.imec.msu.ru/ )

• http://shamolin2.imec.msu.ru/art-112.pdf

... Sur le CEI . ... Condition d??tudes . ... Votre demande d inscription doit galement inclure une copie des premi res pages de votre passeport. ... L enseignement au Centre est en russe selon les plans d tudes et les programmes du Centre. ... Nos tudiants peuvent utiliser la biblioth que, les collections audio et vid o du Centre, ainsi que d acheter les mat riels d tude exig s. Le CIE fournit aux tudiants les documents officiels n cessaires, v rifiant leur statut en tant qu tudiant de l Universit . ...

Еще в разделе: (Показать все результаты (>262) - www.cie.ru/ )

• Enregistrement :: Condition d??tudes :: CEI
• Logement :: Condition d??tudes :: CEI
• Inscription :: Condition d??tudes :: CEI

... 3 ґ Sternberg State Astronomical Institute, Moscow, :jeanna@sai.msu.ru The graphic method of the analysis of an arrangement of linear structural elements on geographical and geological maps of continents (A.V.Dolitsky, [1]) has allowed to find out global stress fields of the past and among them one which directions (the main normal and maximal tangents) describe more than 80 % of all linear elements of a relief. ... The found poles share program way on density of an arrangement on 3-4 groups. ...

Еще в разделе: (Показать все результаты (>93) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Rod/Publications/ms34/MS060.pdf
• http://selena.sai.msu.ru/Chik/Publications/ms40/17_Chikmachev_etal.pdf
• http://selena.sai.msu.ru/Bus/Publications/UFN2007(Bus_etal)(engl).PDF

... Главная -> Фильмы -> Important c'est d'aimer, L' . ... Фильмы . ... Important c'est d'aimer, L' . ... Jacques Dutronc . Claude Dauphin . ... Michel Robin . Guy Mairesse . ... Jacques Boudet . ... Jacques Jourdan . Claude Legros . ... Michel Such . Jacques Van Dooren . ... G?rard Zimmermann . ... Michel Berreur . Guy Delorme . ... Michel Duchaussoy . ... G?rard Moisan . ...

Еще в разделе: (Показать все результаты (>84) - kinfo.ru/ )

• Very Important Person - Фильмы - Kinfo.ru
• Important News - Фильмы - Kinfo.ru
• ?v?nement le plus important .. - Фильмы - Kinfo.ru

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>169) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Vestnik

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>206) - www.genebee.msu.ru/ )

• GEA :: Gene Expression Analysis
• Screening protein sequence against PROSITE databank
• DIMACS Series in Discrete Mathematics

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>4) - npidb.belozersky.msu.ru/ )

Anisotropy of Cosmic Rays. Origins, experiments, data analysis problems & methods. ... ANTARES problems and methods. ... 2D? experiments Name Tibet Air Shower Array Position 90.522o E, 30.102o N; 4300 m above sea level 30.11 N, 4300m a.s.l. Gran Sasso, 2000m Caucasus, 1700m (40deg N, 113 deg W), atmospheric depth of 860 gm/cm2 Energy 4,6.2,12,50, 300 TeV Gamma /CR mix Time 1997-1999 TibetII, 1999-2001 TibetIII (bigger HD array). 4 years 1 year Statistics 7x109 in ~1000 days Rate Ang. ...

Еще в разделе: (Показать все результаты (>26) - antares.sinp.msu.ru/ )

. General Information . News . Organizing Committee . Program . Registration . Registered participants . Symposium expenses . Accommodation and meal . Important deadlines . Presentation information . Abstract submission . Cultural Program . Travel information . Contact information . 14 European Symposium on . Gas Phase Electron Diffraction . 24-28 June 2011 . M. V. Lomonosov Moscow State University . 1 February 2011 . deadline for Registration . 20 April 2011 . deadline for Abstract submission .

Еще в разделе: (Показать все результаты (>15) - ged.chem.msu.ru/ )

... The paper applies the method of integrated language description to the study of `truth' concepts in Russian to explain a hitherto unaccounted for polysemy of the Russian word pravda Keywords: linguistics, semantics There has been abundant research on the Russian concept of `truth' [Levin 1994, Arutiunova 1995, Bulygina & Shmelev 1997, Wierzbicka 2002], mainly focused on the distinctions between two kinds of `truth' found in Russian - pravda `factual truth' (as in - Ja tam ne byl. ...

Еще в разделе: (Показать все результаты (>327) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/madariaga.pdf
• http://www.philol.msu.ru/~otipl/new/mscl/2008/abstracts/knyazev-perkova.pdf
• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/romanova.pdf

Еще в разделе: (Показать все результаты (>50) - dfgm.math.msu.su/ )

• Photo intro

Moscow Astronomical Plate Archives: . Contents, Digitization, Current and Possible Applications . ... We describe the astronomical plate archives in Moscow and Zvenigorod and the existing digitization projects. ... 2 The Plate Archive of the Sternberg Institute . The contents of the most important Moscow astronomical plate archive, that of the Sternberg Astronomical Institute, was briefly presented in Shugarov et al. [1] in 1999. ... THE MOSCOW PLATE COLLECTION (STERNBERG INSTITUTE) . ...

Еще в разделе: (Показать все результаты (>16) - www.sai.msu.ru/ )

... Las clases inician el 01 de Septiembre . ExАmenes Ordinarios Finales: del 01 al 25 de Diciembre . ... Los exАmenes (parciales) no son calificados cuantitativamente. ... El alojamiento en los dormitorios para estudiantes varМa desde $165.00 Dls. mensuales (dependiendo de las condiciones de equipamiento de la vivienda). ... Es importante aclarar que no existe ningЗn tipo de beca para estudiantes internacionales. ... 203 000 . ... Para mayor informaciСn, por favor no dude en contactarnos. ...

Еще в разделе: (Показать все результаты (>29) - foroff.phys.msu.ru/ )

• Глубокоуважаемые коллеги
• Postdoctoral training of foreign scientists at Physical Department

EQUIVALENT DIPOLES APPROACH TO THE ELECTRICAL FIELD VECTOR MEASUREMENTS DATA INTERPRETING Aleksandr A. Gorbunov, Igor. ... Generalizing the traditional apparent resistivity [pic] for the pole- dipole (half-Schlumberger) array, the apparent resistivity vector [pic] with components [pic] is introduced. ... Considering the layered cross-section as the embedding medium, apparent resistivity vector can be presented as [pic] - the sum of the normal and the anomalous apparent resistivity. ...

Еще в разделе: (Показать все результаты (>68) - geophys.geol.msu.ru/ )

• http://geophys.geol.msu.ru/referenc/boh_aqua.DoC
• Page 2

... Collaborative Research Center for Cluster Ion Beam Process Technology . ...

Еще в разделе: (Показать все результаты (>118) - danp.sinp.msu.ru/ )

Nuclear Instruments and Methods in Physics Research B 150 (1999) 635?639 The combined application of PIXE analysis and thermoluminescence (TL) dating for elucidating the origin of iron manufacturing in Japan N. Hagihara a,* , S. Miono a, Z. Chengzhi a, Y. Nakayama b, K. Hanamoto b, S. Manabe c a Faculty of Science, Osaka City University, Osaka 558-8585, Japan b Ritsumeikan University, Kusatsu, Shiga, Japan c Committee of Education, Katano City, Osaka, ... Keywords: PIXE; TL dating 1. ...

Еще в разделе: (Показать все результаты (>108) - hbar.phys.msu.ru/ )

• http://hbar.phys.msu.ru/gorm/dating/spanish.pdf
• The jump of the second derivative of the moon's elongation
• Dionysius Petavius

Russian Journal of Physical Chemistry, Vol. ... BIOPHYSICAL CHEMISTRY Morphology of DNA-Surfactant Complexes after Their Passing through the Water-Chloroform Interface as Studied by Atomic Force Microscopy A. S. Andreeva*, M. O. Gallyamov ... Moscow, 119899 Russia ** Center of Modern Technologies, Moscow, Russia Received October 5, 1998 Abstract--A statistical analysis of AFM images of DNA-surfactant complexes passed into chloroform from the aqueous phase was performed ... Vol. ...

Еще в разделе: (Показать все результаты (>241) - polly.phys.msu.ru/ )

• PSMTLab - Polyelectrolytes
• Scientific Work
• SfP 974173 Polymer Gels - Summary Report - May 2002

Distributed systems as pattern formation models: space-time behavior investigation and elements of dynamics control". ... A new method of local dynamics analysis of coupled map lattices (CML) was proposed. ... New effects of global behavior of CML was found. Maps can represent some systems. ... And the points represent state of the system, which was determined by Rybalko method (Lambda values; color = period = order, black = zero period = chaos) and the period of cycle (P values). ...

Еще в разделе: (Показать все результаты (>74) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/loskutov/PDF/JETP417.pdf
• http://chaos.phys.msu.ru/loskutov/PDF/JPA_2010_MD.pdf
• http://chaos.phys.msu.ru/loskutov/PDF/TMPh_time_series.pdf