... Master Education . Second Education . ... Entrance requirements . ... personal statement addressed to the rector of MSU, containing the post-graduate course title and masters? program name . ... All applicants for full-time course (Russian students, both on scholarship and contract) are subject to following examinations: . ... All applicants to evening courses take an oral examination in the field of expertise. ... Второе высшее образование: second_edu@cs.msu.ru, 6-й этаж, комната 640, тел. ...

Еще в разделе: (Показать все результаты (>9) - hcs.cmc.msu.ru/ )

• Master programљ"Decision Engineering in Economics and Finance" | Магистерское и

pic] [pic] PARTNERSHIP AGREEMENT between the Russian Rectors' Union and the Russia Machine Builders' Union The Russian Rectors' Union (RRU) and the Russian Machine Builders' Union (RMBU), hereinafter referred to as The Parties Confirming the importance of the further development and strengthening of partnership relations between the scientific-educational ...

Еще в разделе: (Показать все результаты (>37) - www.rsr-online.ru/ )

... Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr. ... Lorem ipsum dolor sit amet. Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. <div class="myclass">...</div> . ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna. ...

Еще в разделе: (Показать все результаты (>6) - physcontrol.phys.msu.ru/ )

• List All Categories

... heat and mass transfer; . kinetic theory of gases; . ... The technique had been developed for calculating destruction of melting vitreous bodies in hypersonic gas flows taking into account the internal radiative transfer. ... The problem of flow in the chemically non-equilibrium boundary layer at a stagnation point of blunt body had been solved by the asymptotic method and formulas for the heat and diffusion fluxes to a surface of any catalycity had been obtained. ...

Еще в разделе: (Показать все результаты (>7) - lab106.imec.msu.ru/ )

... He distributes these gifts in sacks (each sack can contain from 1 to n items) and puts the sacks with gifts around the Christmas tree (only the content of the sacks and their ordering on the circle around the tree are important). ... A river falling into a sea forms a delta which is a system of branches consisting of channels without inner intersections. (a) Suppose that in a given delta there are exactly n different (i.e. differing by at least one channel) routes down the stream. ...

Еще в разделе: (Показать все результаты (>2) - www.universe.msu.ru/ )

Warning: scandir(./db): failed to open dir: No such file or directory in /home/swx/public_html/models/database/modules/db.php on line 2 Warning: scandir(): (errno 2): No such file or directory in /home/swx/public_html/models/database/modules/db.php on line 2 . This database contains Solar Energetic Particles(SEP) fluences, measured from august 1997 till 2006 with the instruments on the satellites GOES and ACE. ...

Еще в разделе: (Показать все результаты (>8) - swx.sinp.msu.ru/ )

• http://swx.sinp.msu.ru/models/database/modules/db2.php
• SWX - Главная

Section 1 Sets 1 Sets After working through this section, you should be able to: (a) use set notation; (b) determine whether two given sets are equal and whether one given set is a subset of another; (c) find the union, intersection and difference of two given sets. ... Each ob ject in a set is an element or memb er of the set, and the elements b elong to the set, or are in the set. ... Thus the number of different subsets with k elements of a set with n elements is n в (n - 1) в ··· в (n - k +1) . ...

Еще в разделе: (Показать все результаты (>21) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/Model_rendering.pdf
• http://www.eng.math.msu.su/download/Academic_English_part3.pdf
• http://www.eng.math.msu.su/download/plan.pdf

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>184) - www.genebee.msu.ru/ )

• Biochemistry (Moscow), Vol
• GeneBee BLAST 2.2.8 Services Help
• GeneBee BLAST 2.2.22+ Services Help

Diploma thesis abstract Kostylev Andrey Yurievich Spatial field distribution laser beam control by means of electrically driven phase elements In this work we present results of experimental formation of beams with vortex wave front dislocation by means of phase optical elements: spiral phase plate, bimorph adaptive mirror, controlled liquid crystal modulator. ... Gerchberg-Saxton algorithm has been implemented to determine required liquid crystal modulator phase. ...

Еще в разделе: (Показать все результаты (>137) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2006/Voronov_Ponomarev_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2006/Konjashkin_Olenin_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2014/Ksenofontov_Savelev_en.pdf

Biochemical analysis of the metabolism of small rodents living in different radioecological conditions . ... The initial differences of metabolism and their modification under the conditions of radioactive pollution of the environment are presented on the basis of the complex of biochemical parameters of two ecologically different species of small rodents ( Apodemus uralensis and Myodes rutilus ). ...

Еще в разделе: (Показать все результаты (>1389) - zmmu.msu.ru/ )

• Russian Journal of Theriology
• Igor Ya
• Circadian activity rhythms of dwarf hamsters (Phodopus spp.) under laboratory

... Главная -> Фильмы -> The Fifth Element . ... Фильмы . ... The Fifth Element . ... John Neville . John Bluthal . ... Каждые пять тысяч летљоткрываются двери между измерениями иљтемные силы стремятся нарушить существующую гармонию. Каждые пять тысяч летљВселенной нужен герой, способный противостоять этому злу. ... В фильме множество мелких деталей и ньюансов, что делает повторный просмотр не менее увлекательным, чем первый. ... Хороший фильм, конечно. ... Имхо, не лучший фильм Люка Бессона. ...

Еще в разделе: (Показать все результаты (>199) - kinfo.ru/ )

• Forbrydelsens element - Фильмы - Kinfo.ru
• Kameo: Elements of Power - Фильмы - Kinfo.ru
• Element of Doubt - Фильмы - Kinfo.ru

... There exists a homomorphism a: A --~ U, (L~), associating with every monomial 7x~ 1 . ... In the sequel we shall always argue modulo the elements of degree -> 2p. We consider the formal series i (t) ::: ~=<>. -i.-~ Let g(t) be the series which is defined by the equation g(f(t)) = t. Put ~o ': !t,: (t) ---: t~, @i (t)) -~ = ~=o h~t ~ , and x~ ~176 ~/~ l--n Gn (Xl) = 2L=0 ~Xl ' If qo(t) is a formal Laurent series, then we denote by [r term. ... 4, No. 4, 72i THEOREM 1. ... Assume the LEMMA 1. ...

Еще в разделе: (Показать все результаты (>149) - higeom.math.msu.su/ )

• Publications (English)
• Publications (Russian)

... Matrix Reloaded and Fifth Element HDTVRip . ... Re: Matrix Reloaded HDTVRip [ re: a47 ] . ... Re: Matrix Reloaded and Fifth Element HDTVRip [ re: a47 ] . ... Re: Matrix Reloaded and Fifth Element HDTVRip [ re: Unit ] . ... Re: Matrix Reloaded and Fifth Element HDTVRip [ re: Batman ] . ... Re: Matrix Reloaded and Fifth Element HDTVRip [ re: Pendalf ] . ... Re: Matrix Reloaded and Fifth Element HDTVRip [ re: Wintermute ] . ... Re: Matrix Reloaded and Fifth Element HDTVRip [ re: Spin ] . ...

Еще в разделе: (Показать все результаты (>5396) - www.snto-msu.net/ )

• скачайте Adobe Photoshop Elements 6 (ссылки внутри) - Public forum of MSU
• как в матлабе записать квадратную матрицу в файл тхт? - Public forum of MSU
• как настроить smb.conf и запустить демоны smbd и nmbd? - Public forum of MSU

HEXAGONAL TUNGSTEN BRONZE AND PYROCHLORE TYPE CRYSTALS . ... All these compounds have the structure of hexagonal tungsten bronze type with wide channels along c axis in which cations A + are situated. It was found that many of these compounds undergo ferroelectric transitions . ... Ferroelectrics with the structure of hexagonal tungsten bronze type. V.K.Yanovskii, V.I.Voronkova, and I.P.Klimova. ... New compounds AB n W 3-n O 9 with the structure of hexagonal tungsten bronze. ...

Еще в разделе: (Показать все результаты (>215) - polly.phys.msu.ru/ )

• lab Carousel With Variable Elements Widths | Lemmon jQuery
• site Carousel With Variable Elements Widths | Lemmon jQuery
• PSMTLab - Polyelectrolytes

... Inorganic Synthesis . ... 2001 . Supervised by Dr. A.V. Shevelkov . Alexander V. Akopyan New complex anionconducting Bismuth-Vanadium oxofluorides 2001 Supervised by Prof. V.A. Dolgikh . ... Synthesis, structure and properties of tifluoroacetates of aluminum, chromium and zirconium. ... Tin pnictide-halides with the structure of clathrate-I: synthesis, structure and properties. ... Synthesis, structure and properties of new compounds based on Cu(II), Be(II) and Tm(III) carboxylates. ...

Еще в разделе: (Показать все результаты (>57) - www.inorg.chem.msu.ru/ )

• Inorganic Synthesis Laboratory - Supramolecular and Cluster Compounds
• Inorganic Chemistry Division
• Joint Semiconductors Surface Study group

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.ru/pages/pdf/nar2004.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2002_1.pdf

To commutative factorization of algebraic matrices Andrey V. Shanin1 , Eugeny M. Doubravsky2 Russia, 119899, Moscow, Moscow State University, Department of Physics, 2 Department of Mechanics and Mathematics October 4, 2005 Abstract The problem of matrix factorization motivated by diffraction or elasticity is studied. ... 7 3.4 Bypass matrices and reformulation of factorization problem Let G be an algebraic matrix, and let W be the set of words associated with this matrix. ... Consider matrix M (k ). ...

Еще в разделе: (Показать все результаты (>45) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/dd01.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/grating5.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/sepvar.pdf

BASIC EDGES METRICS FOR IMAGE DEBLURRING A.V. Nasonov, A.S. Krylov 2 2 1 Laboratory of Mathematical Methods of Image Processing, Faculty of Computational Mathematics and Cybernetics, Lomonosov Moscow State University, nasonov@cs.msu.ru, kryl@cs.msu.ru The paper presents a new adaptive full reference method for quality measurement of image deblurring algorithms. ... Edge displacement. ... Full-reference basic edges metrics for quality measurement of image deblurring algorithms have been proposed. ...

Еще в разделе: (Показать все результаты (>117) - imaging.cmc.msu.ru/ )

• Research | Laboratory of Mathematical Methods of Image Processing

... Site is discontinually updating by professional biologists and students of biology faculty of MSU. ... All Journals . This list contains all journals in JCatalog database. Select the letter and click it. If there is no action when clicking then no journals begins from this letter. Set the mouse cursor on any letter and you will know the number of journals; gray letter colour means that no journals begins from it. ... View whole journal list(1749) . ... Index | All journals . ...

Еще в разделе: (Показать все результаты (>27) - journals.genebee.msu.ru/ )

• JCatalog journal list

... The Rural Roads as the Structural Element of the Roman Organization of Land Exploitation, . ... In practice of roman organization of land exploitation those axes became the roads built in coordinates. The divisor-limit bounds were built parallel to the main axes. ... As a matter of fact the roman organization of land exploitation became the measurement (limitatio) as those roads crossed at right angles and made the "lattice of measuring" resembling a chess-board by scheme. ...

Еще в разделе: (Показать все результаты (>146) - hist.msu.ru/ )

• Morozov's Social Policy: Nickolskaya Manufacturing (1860s - beginning of the
• Moscow University
• The Impact of Orthodox and Western Christianity on Societies