. If you see this page, the nginx web server is successfully installed and working. Further configuration is required. For online documentation and support please refer to nginx.org . Commercial support is available at nginx.com . Thank you for using nginx.
... Reports on progress and error are always recorded in the log file of the program. ... UT date of the measurement finish in YYYY-MM-DD format UT time of the measurement finish in hh:mm:ss format Average flux in A aperture Average flux in B aperture Average flux in C aperture Average flux in D aperture Normalized variance of flux in A aperture Normalized variance of flux in B aperture Normalized variance of flux in C aperture Normalized variance of flux in D ...
... Поиск по МГУ | Лента новостей | ... О проекте . ... Please, enter the code that you see below in the input field. This is for blocking bots that try to post this form automatically. If the code is hard to read, then just try to guess it right. If you enter the wrong code, a new image is created and you get another chance to enter it right. ... 2003 2011 MsuNews.Ru Новости МГУ . 2003 2011 Разработка и дизайн MMForce.Net . ... Экспорт новостей (RSS) ...
AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...
... Study of the Russian " Silver Age " neology . ... Dictionaries of neologisms constitute an important part of lexicography. ... The peculiarity of our project is the full scope of text (at least published) considered and uniformity of description: dictionary entries of all the authors’ neologisms have the same format (suggested for Khlebnikov’s neology). ... Khlebnikov's neology (N. N. Pertsova). In 1995 "The Dictionary of Khlebnikov's Neologisms" was published. ...
... Faculty of Physics . ... The scientific group of Prof. Alexander Tishin and Dr. V.I. Zverev (Department of General Physics and Physics of Condensed Matter, Faculty of Physics , Moscow State University), which is engaged in research of new functional materials, in 2015 completed a series of complex investigations of magnetic and magnetocaloric properties of a number of high-purity single -crystalline 'heavy' lanthanide metals in the temperature range 4.2 -350 K in ...
Title Author Key words Nevskaya T.A. Hybrid wars' information component hybrid war, aspects of hybrid warfare, information warfare The war of the new generation hybrid war, the information component which is directed not so much on the direct destruction of the enemy, how to achieve the goals without warfare. Fighting in the information field is no less important than immediate military action. Abstract
... Our primary objective is the design and implementation of applied software tools for data processing, output and circulation of computer literature. ... Software tools for signal processing in medicine and engineering CONAN-m and CONAN-t. Statistical stable analysis tool for regression and factor models SIGN. ... Figurnov V.A. "IBM PC for Users" (in Russian). ... Boldin M.V., Simonova G.I., Tyurin Yu.N. "Sign Statistical Analysis of Linear Models" (in Russian and in English ). ... InCo . ...
... Too Close to a Black Hole . ... On the right is the same star field but this time with a black hole superposed in the center of the frame. ... Black holes are thought to be the densest state of matter, and there is indirect evidence for their presence in stellar binary systems and the centers of globular clusters, galaxies, and quasars. ... NASA Official: Jay Norris. ... Publications with keywords: black hole - gravitational lens . Publications with words: black hole - gravitational lens . ...
... The Science Operation Department is composed of Astronomers, Telescope Instruments Operators(TIOs) and Data Handling Administrators(DHAs). ... Astronomers have proposed several methods to quantitatively measure the amount of turbulence above the telescope, which the most common ones is Differential Image Motion Monitor (DIMM). In optical testing, the Hartmann test is the common method to test the quality of optical components. ... Hartmann mask consists of 48 lenses. ...
... Home News Program Committee Organizing Committee Program Plenaries Special Sessions Registration Abstracts Accommodation Important dates Contacts Poster Links Conference Venue Video . Important dates . ... The beginning of the conference: June 17, 2008 . The closing of the conference: June 22, 2008 . ...
... Russia and France have contributed significantly to scientific and research progress and cultural development of mankind. ... This is the reason for the international academic community to be closely monitoring today the reform, which is taking place in the educational systems of Russia and France, believing that the outcome of these changes will create new opportunities to strengthen the intellectual capacity and adapt to new economic and technological trends for a large number of countries. ...
... Generation of recombinant antibodies and means for increasing their affinity. ... For example, application of recombinant technologies resulted in antibody preparation of high affinity significantly exceeding the initial affinity of natural antibodies. In this review we summarize information about the structure, modes of preparation, and application of recombinant antibodies and their fragments and also consider the main approaches used to increase antibody affinity. ...
. If you see this page, the nginx web server is successfully installed and working on Debian. Further configuration is required. For online documentation and support please refer to nginx.org . Please use the reportbug tool to report bugs in the nginx package with Debian. However, check existing bug reports before reporting a new bug. Thank you for using debian and nginx.
A very important stage in a story of formation of any new science is the shift from discussion of situation which are possible but do not occur in practice due to some reason to recognition of real phenomena of interest. ... We suggest to consider computer viruses as this new specific form of life which is coming in the contact with our form of life. ... Computer life has been created by human being, the role of independent evolution of computer viruses seems to be still negligible. ...
... The Semantic Dictionary RUSLAN-1, the last version being Russian-to-English direction, is a tool for semantic and informational analysis of any coherent Russian text. The rich semantic information contained in the dictionary makes possible local, within one phrase, semantic interpretation as well as semantic analysis of coherent texts. ... Text understanding is very closely related to information analysis (Leontyeva 2000). ... We therefore call it "relative understanding". ...
Kinetics of redox reactions of Pu(V) in solutions containing different fractions of humic substances O.A. Blinova*, A.P. Novikov, I.V. Perminova+, R.G. Haire *A.N.Frumkin Institute of Physical Chemistry and Electrochemistry, Moscow , Russia , Vernadsky Institute of Geochemistry and Analytical Chemistry, Moscow , Russia , + Lomonosov Moscow State Univercity, Moscow , Russia , Oak Ridge National Laboratory Humic ...
[
Текст
]
Ссылки http://www.mgumus.chem.msu.ru/publication/2006/2006-blinova-kinetics.pdf -- 167.9 Кб -- 09.07.2007
[
Текст
]
Ссылки http://mgumus.chem.msu.ru/publication/2006/2006-blinova-kinetics.pdf -- 167.9 Кб -- 09.07.2007 Похожие документы
... Главная . Новости . ... Каталог с/х ресурсов . ... Forums . Helps and Supports . ... Каталог предприятий . Каталог товаров . ... Обратная связь . ... Получайте последние обновления, новости и многое другое.. ... Helps and Supports Back to Top . ...